CLOCK Polyclonal antibody 18094-1-AP proteintech
$149.00
In stock
SKU
18094-1-AP
| Catalog Number | 18094-1-AP |
| Synonyms | bHLHe8, Circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, EC:2.3.1.48, KAT13D |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ChIP, ELISA |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells, PC-3 cells |
| Tested Applications — Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive WB detected in | HEK-293 cells, HeLa cells, PC-3 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag12826 Product name: Recombinant human CLOCK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC041878 Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFISNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWL Predict reactive species |
| Full Name | clock homolog (mouse) |
| Calculated Molecular Weight | 846 aa, 95 kDa |
| Observed Molecular Weight | 95-110 kDa |
| GenBank Accession Number | BC041878 |
| Gene Symbol | CLOCK |
| Gene ID (NCBI) | 9575 |
| RRID | AB_2878497 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15516 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CLOCK antibody 18094-1-AP | Download protocol |
| IHC protocol for CLOCK antibody 18094-1-AP | Download protocol |
| IP protocol for CLOCK antibody 18094-1-AP | Download protocol |
| WB protocol for CLOCK antibody 18094-1-AP | Download protocol |
| human | WB J Agric Food Chem Capsaicin Attenuates Oleic Acid-Induced Lipid Accumulation via the Regulation of Circadian Clock Genes in HepG2 Cells. Authors - Run Li View Article |
| mouse | WB J Agric Food Chem 3-MCPD Induced Mitochondrial Damage of Renal Cells Via the Rhythmic Protein BMAL1 Targeting SIRT3/SOD2 Authors - Shuang Guan View Article |
| Verdiana (Verified Customer) (05-03-2022) | The bands are clear, there is no background noise even if the bands signal is not very strong. Good Ab. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Lymphoblastic cell line |
| Citations | 31 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:250-1:1000 IF/ICC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Circadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. The calculated molecular weight of CLOCK is 95kDa, we detected a 95-110 kDa protein by western blot. Our result is similar to the result of reseach paper (PMID: 30683868). Protocols Product Specific Protocols IF protocol for CLOCK antibody 18094-1-AP Download protocol IHC protocol for CLOCK antibody 18094-1-AP Download protocol IP protocol for CLOCK antibody 18094-1-AP Download protocol WB protocol for CLOCK antibody 18094-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A druggable copper-signalling pathway that drives inflammation
Journal: Nature | Authors: Stéphanie Solier | Species: human | Application: WB - Metastatic effects of perfluorooctanoic acid (PFOA) on Drosophila melanogaster with metabolic reprogramming and dysrhythmia in a multigenerational exposure scenario
Journal: Sci Total Environ | Authors: Fangnon Firmin Fangninou | Application: WB - Piperine Improves Lipid Dysregulation by Modulating Circadian Genes Bmal1 and Clock in HepG2 Cells.
Journal: Int J Mol Sci | Authors: Weiyun Zhang KD Validated | Species: human | Application: WB - 3-MCPD Induced Mitochondrial Damage of Renal Cells Via the Rhythmic Protein BMAL1 Targeting SIRT3/SOD2
Journal: J Agric Food Chem | Authors: Shuang Guan | Species: mouse | Application: WB - A long noncoding RNA perturbs the circadian rhythm of hepatoma cells to facilitate hepatocarcinogenesis.
Journal: Neoplasia | Authors: Ming Cui | Species: human | Application: WB,IHC - Capsaicin Attenuates Oleic Acid-Induced Lipid Accumulation via the Regulation of Circadian Clock Genes in HepG2 Cells.
Journal: J Agric Food Chem | Authors: Run Li | Species: human | Application: WB - Long-term low-dose exposure to 9-chlorophenanthrene induces liver lipid accumulation via disrupting circadian rhythm
Journal: J Hazard Mater | Authors: Meitong Liu | Species: mouse | Application: WB,IF - Metastatic effects of perfluorooctanoic acid (PFOA) on Drosophila melanogaster with metabolic reprogramming and dysrhythmia in a multigenerational exposure scenario
Journal: Sci Total Environ | Authors: Fangnon Firmin Fangninou | Application: WB - BMAL1-mediated circadian-ferroptosis crosstalk drives neuronal vulnerability after TBI.
Journal: Free Radic Biol Med | Authors: Ruoyu Huang | Species: mouse | Application: WB,IF - Spatiotemporal Circadian Oscillator Manipulation for Enhanced Ovarian Cancer Therapy Using a Versatile Nanoplatform
Journal: ACS Appl Mater Interfaces | Authors: Jiamin Lin | Species: mouse | Application: WB,IF - Chronic paternal exposure to low-dose OBS reprograms progeny's intestinal cholesterol metabolism and increases IBD susceptibility.
Journal: Environ Pollut | Authors: Wang Yang | Species: human | Application: IHC - Circadian Rhythm Disorder-Related Dysfunctions are Exacerbated by Aging and Ameliorated by Time-Restricted Feeding.
Journal: Neurosci Bull | Authors: Fengjiao Huo | Species: mouse | Application: WB,ChIP - 3-MCPD Induced Mitochondrial Damage of Renal Cells Via the Rhythmic Protein BMAL1 Targeting SIRT3/SOD2
Journal: J Agric Food Chem | Authors: Shuang Guan | Species: mouse | Application: WB - Capsaicin Attenuates Oleic Acid-Induced Lipid Accumulation via the Regulation of Circadian Clock Genes in HepG2 Cells.
Journal: J Agric Food Chem | Authors: Run Li | Species: human | Application: WB - Melatonin refines ovarian mitochondrial dysfunction in PCOS by regulating the circadian rhythm gene Clock
Journal: Cell Mol Life Sci | Authors: Wenxiu Chen | Species: mouse,human | Application: WB,IHC - HlncRNA-1 integrates the hepatic circadian clock with lipid metabolism by targeting Hdlbp.
Journal: Commun Biol | Authors: Chen Sun | Species: mouse | Application: WB - Piperine Improves Lipid Dysregulation by Modulating Circadian Genes Bmal1 and Clock in HepG2 Cells.
Journal: Int J Mol Sci | Authors: Weiyun Zhang | Species: human | Application: WB - Dynamic and functional analyses of exosomal miRNAs regulating cellular microenvironment of ovarian cancer cells
Journal: J Ovarian Res | Authors: Zhaoxia Wang | Species: human | Application: WB - Resveratrol reversed ambient particulate matter exposure-perturbed oscillations of hepatic glucose metabolism by regulating SIRT1 in mice
Journal: Environ Sci Pollut Res Int | Authors: Jinjin Jiang | Species: human | Application: WB - Ginsenosides alleviate the progression of hepatic fibrosis by targeting the liver circadian clock gene CLOCK.
Journal: Mol Med Rep | Authors: Jiawen Yu | Species: mouse,human | Application: WB,IF - Level of constitutively expressed BMAL1 affects the robustness of circadian oscillations
Journal: Sci Rep | Authors: Apirada Padlom | Species: human | Application: WB - RORα fine-tunes the circadian control of hepatic triglyceride synthesis and gluconeogenesis
Journal: Sci Rep | Authors: Chloé Monnier - A long noncoding RNA perturbs the circadian rhythm of hepatoma cells to facilitate hepatocarcinogenesis.
Journal: Neoplasia | Authors: Ming Cui | Species: human | Application: WB,IHC - Circadian Clock Dysfunction Exacerbate Autistic-Like Behaviour and Wnt/β-Catenin Signalling Dysregulation in ASD Mice and Treatment of Melatonin.
Journal: J Cell Mol Med | Authors: Yuxing Zhang | Species: mouse | Application: WB - Circadian Clock Dysfunction Exacerbate Autistic-Like Behaviour and Wnt/β-Catenin Signalling Dysregulation in ASD Mice and Treatment of Melatonin.
Journal: J Cell Mol Med | Authors: Yuxing Zhang | Species: mouse | Application: WB - Loss of ARNTL Enhances ER Stress and Apoptosis in CKD Through Disruption of NRF2 Signaling
Journal: FASEB J | Authors: Li He | Species: mouse,human | Application: WB - Suppression of endoplasmic reticulum stress by 4-PBA enhanced atherosclerotic plaque stability via up-regulating CLOCK expression
Journal: Pathol Res Pract | Authors: Guanglang Zhu | Species: mouse,human | Application: WB,IF - 1,3-dichloro-2-propanol caused lipid droplets accumulation by suppressing neutral lipases via BMAL1 in hepatocytes
Journal: Food Chem Toxicol | Authors: Yong Fan | Species: mouse,human | Application: WB - Suppression of DLBCL Progression by the E3 Ligase Trim35 Is Mediated by CLOCK Degradation and NK Cell Infiltration.
Journal: J Immunol Res | Authors: Xiyan Tan | Species: human | Application: WB,IHC - The circadian rhythm regulates branched-chain amino acids metabolism in fast muscle of Chinese perch (Siniperca chuatsi) during short-term fasting by Clock-KLF15-Bcat2 pathway
Journal: Br J Nutr | Authors: Xin Zhu | Application: WB - Subtype-specific circadian clock dysregulation modulates breast cancer biology, invasiveness, and prognosis
Journal: bioRxiv | Authors: Jan A Hammarlund | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
