CHRNA5 Monoclonal antibody 66363-1-Ig proteintech
$149.00
In stock
SKU
66363-1-Ig
| Catalog Number | 66363-1-Ig |
| Synonyms | CHRNA5, LNCR2, NACHRA5 |
| Host | Mouse |
| Reactivity | human, mouse, pig and More (1) |
| Reactivity | human, mouse, pig, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive WB detected in | mouse skeletal muscle tissue, human skeletal muscle tissue, C2C12 cell, pig skeletal muscle tissue, A549 cells |
| Tested Applications — Positive IHC detected in | human bladder tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse skeletal muscle tissue, human skeletal muscle tissue, C2C12 cell, pig skeletal muscle tissue, A549 cells |
| Positive IHC detected in | human bladder tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, pig |
| Cited Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4447 Product name: Recombinant human CHRNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-251 aa of BC033639 Sequence: GAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPL Predict reactive species |
| Full Name | cholinergic receptor, nicotinic, alpha 5 |
| Calculated Molecular Weight | 468 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC033639 |
| Gene Symbol | CHRNA5 |
| Gene ID (NCBI) | 1138 |
| RRID | AB_2881743 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P30532 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CHRNA5 antibody 66363-1-Ig | Download protocol |
| WB protocol for CHRNA5 antibody 66363-1-Ig | Download protocol |
| human,mouse | IHC J Invest Dermatol Chrna5 is overexpressed in psoriasis patients and promotes psoriasis-like inflammation in mouse models. Authors - Jing Wang KD Validated View Article |
| human | IHC Toxicology The role of α5-nicotinic acetylcholine receptor/NLRP3 signaling pathway in lung adenocarcinoma cell proliferation and migration. Authors - Ying Jia View Article |
| Citations | 16 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:50-1:500 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 3G8C11 |
| Conjugation | Unconjugated |
Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. Variants in the CHRNA5 gene are associated with nicotine dependence and lung cancer risk. Protocols Product Specific Protocols IHC protocol for CHRNA5 antibody 66363-1-Ig Download protocol WB protocol for CHRNA5 antibody 66363-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Acetylcholine promotes chronic stress-induced lung adenocarcinoma progression via α5-nAChR/FHIT pathway
Journal: Cell Mol Life Sci | Authors: Yang Jiao KD Validated | Species: human,mouse | Application: WB,IHC - Chrna5 is overexpressed in psoriasis patients and promotes psoriasis-like inflammation in mouse models.
Journal: J Invest Dermatol | Authors: Jing Wang KD Validated | Species: human,mouse | Application: IHC - Nicotinic acetylcholine receptors regulate growth hormone in pituitary somatotrophs of tigers
Journal: Commun Biol | Authors: Lulu Liu | Application: WB - α5-nAChR associated with Ly6E modulates cell migration via TGF-β1/Smad signaling in non-small cell lung cancer.
Journal: Carcinogenesis | Authors: Qian Zhang | Species: human | Application: IHC - PLEK2 mediates metastasis and invasion via α5-nAChR activation in nicotine-induced lung adenocarcinoma
Journal: Mol Carcinog | Authors: Qiang Li | Species: human | Application: IHC - The role of α5-nicotinic acetylcholine receptor/NLRP3 signaling pathway in lung adenocarcinoma cell proliferation and migration.
Journal: Toxicology | Authors: Ying Jia | Species: human | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
