NAMPT/PBEF Monoclonal antibody 66385-1-Ig proteintech
$149.00
In stock
SKU
66385-1-Ig
| Catalog Number | 66385-1-Ig |
| Synonyms | Nampt, Visfatin, 3D4D8, EC:2.4.2.12, NAmPRTase |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | LNCaP cells, human heart tissue, human skeletal muscle tissue, MCF-7 cells, mouse skeletal muscle tissue, Neuro-2a cells, rat heart tissue, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Jurkat cells, PC-3 cells, HT-29 cells, HCT 116 cells, MOLT-4 cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells, HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:20000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | LNCaP cells, human heart tissue, human skeletal muscle tissue, MCF-7 cells, mouse skeletal muscle tissue, Neuro-2a cells, rat heart tissue, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Jurkat cells, PC-3 cells, HT-29 cells, HCT 116 cells, MOLT-4 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2434 Product name: Recombinant human NAMPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC020691 Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV Predict reactive species |
| Full Name | nicotinamide phosphoribosyltransferase |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC020691 |
| Gene Symbol | NAMPT/PBEF |
| Gene ID (NCBI) | 10135 |
| RRID | AB_2881761 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P43490 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for NAMPT/PBEF antibody 66385-1-Ig | Download protocol |
| IHC protocol for NAMPT/PBEF antibody 66385-1-Ig | Download protocol |
| WB protocol for NAMPT/PBEF antibody 66385-1-Ig | Download protocol |
| mouse,human | WB J Med Chem Design of FK866-Based Degraders for Blocking the Nonenzymatic Functions of Nicotinamide Phosphoribosyltransferase Authors - Tiangong Lu View Article |
| mouse | IF Adv Biol (Weinh) NAMPT/NAD+ /PARP1 Pathway Regulates CFA-Induced Inflammatory Pain via NF-κB Signaling in Rodents Authors - Yi Dai View Article |
| human | WB Cell Rep NAD+ supplement potentiates tumor-killing function by rescuing defective TUB-mediated NAMPT transcription in tumor-infiltrated T cells. Authors - Yuetong Wang View Article |
| Citations | 19 |
| Dilutions | WB : 1:5000-1:20000 IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 3D4D8 |
| Conjugation | Unconjugated |
Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is localized in cytoplasm and expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism. Protocols Product Specific Protocols IF protocol for NAMPT/PBEF antibody 66385-1-Ig Download protocol IHC protocol for NAMPT/PBEF antibody 66385-1-Ig Download protocol WB protocol for NAMPT/PBEF antibody 66385-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer
Journal: Cell Metab | Authors: Yu Jiang | Species: mouse,human | Application: WB,IF - NAMPT-targeting PROTAC and nicotinic acid co-administration elicit safe and robust anti-tumor efficacy in NAPRT-deficient pan-cancers
Journal: Cell Chem Biol | Authors: Xiaotong Zhu | Species: mouse,human | Application: WB - NAMPT/NAD+ /PARP1 Pathway Regulates CFA-Induced Inflammatory Pain via NF-κB Signaling in Rodents
Journal: Adv Biol (Weinh) | Authors: Yi Dai | Species: mouse | Application: IF - Nicotinamide phosphoribosyl transferase regulates cell growth via the Sirt1/P53 signaling pathway and is a prognosis marker in colorectal cancer.
Journal: J Cell Physiol | Authors: Jing-Hua Pan KD Validated | Species: human | Application: WB,IHC - NAD+ supplement potentiates tumor-killing function by rescuing defective TUB-mediated NAMPT transcription in tumor-infiltrated T cells.
Journal: Cell Rep | Authors: Yuetong Wang | Species: human | Application: WB - Design of FK866-Based Degraders for Blocking the Nonenzymatic Functions of Nicotinamide Phosphoribosyltransferase
Journal: J Med Chem | Authors: Tiangong Lu | Species: mouse,human | Application: WB - NAD+ supplement potentiates tumor-killing function by rescuing defective TUB-mediated NAMPT transcription in tumor-infiltrated T cells.
Journal: Cell Rep | Authors: Yuetong Wang | Species: human | Application: WB - Design of FK866-Based Degraders for Blocking the Nonenzymatic Functions of Nicotinamide Phosphoribosyltransferase
Journal: J Med Chem | Authors: Tiangong Lu | Species: mouse,human | Application: WB - Dendritic cells remodel eccrine sweat gland niche metabolism through oxidative phosphorylation during aging.
Journal: J Invest Dermatol | Authors: Yuanli Ye - GD2-directed NAMPT inhibition using antibody-drug conjugates in neuroblastoma.
Journal: Eur J Med Chem | Authors: Jing Liu | Species: human | Application: WB - Hydrogen Sulfide Protects Against Cerebral Ischemia-Reperfusion Injury in Rats via S-Sulfhydrating NAMPT to Enhance Mitochondrial Function and Autophagy in Cerebrovascular Endothelial Cells.
Journal: Pharmaceuticals (Basel) | Authors: La Jiang | Species: rat | Application: WB - Mannan-binding lectin inhibits oxidative stress-induced senescence via the NAD+/Sirt1 pathway
Journal: Int Immunopharmacol | Authors: Yiming Lei | Species: mouse | Application: WB - Regulation of NAD+/NADH Redox Involves the Protective Effects of Ginsenoside Rb1 against Oxygen-Glucose Deprivation/Reoxygenation-Induced Astrocyte Lesions
Journal: Int J Mol Sci | Authors: Ying Liu | Species: mouse | Application: WB - Nicotinamide Ameliorates Deoxynivalenol-Induced Injury in Renal Cells via Inhibiting PARP1 Hyperactivation and Restoring NAD(+) Homeostasis.
Journal: Toxins (Basel) | Authors: Chao Chen | Species: human | Application: WB - Nicotinamide phosphoribosyl transferase regulates cell growth via the Sirt1/P53 signaling pathway and is a prognosis marker in colorectal cancer.
Journal: J Cell Physiol | Authors: Jing-Hua Pan | Species: human | Application: WB,IHC - NAMPT/NAD+ /PARP1 Pathway Regulates CFA-Induced Inflammatory Pain via NF-κB Signaling in Rodents
Journal: Adv Biol (Weinh) | Authors: Yi Dai | Species: mouse | Application: IF - Integrated RNA-seq and scRNA-seq to explore the biological mechanisms of mitophagy-related genes in ulcerative colitis.
Journal: PLoS One | Authors: Jianguo Ma | Species: mouse | Application: WB - Activation of the impaired NAMPT/SIRT7/SOD2 axis restores alveolar progenitor cell homeostasis in idiopathic pulmonary fibrosis and reverses pulmonary fibrosis in mice
Journal: bioRxiv | Authors: Xuexi Zhang | Species: human | Application: WB - The mitochondrial NAD transporter SLC25A51 is a modulator of beta cell senescence and type 2 diabetes
Journal: bioRxiv | Authors: Byung Soo Kong | Species: mouse | Application: WB - Targeting the AKT2-NAMPT phosphorylation axis prevents macrophage senescence to enhance bactericidal activity in septic immunosuppression.
Journal: Int Immunopharmacol | Authors: Qilan Li
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
