Cannabinoid receptor 1 Recombinant monoclonal antibody, PBS Only (Detector) 82787-4-PBS proteintech
$699.00
In stock
SKU
82787-4-PBS
| Catalog Number | 82787-4-PBS |
| Synonyms | CNR1, CANN6, cannabinoid receptor 1 (brain), CB R, CB1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag12625 Product name: Recombinant human CNR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-121 aa of BC074812 Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV Predict reactive species |
| Full Name | cannabinoid receptor 1 (brain) |
| Calculated Molecular Weight | 472 aa, 53 kDa |
| GenBank Accession Number | BC074812 |
| Gene Symbol | Cannabinoid receptor 1 |
| Gene ID (NCBI) | 1268 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P21554 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250285C2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
