CNTN2 Monoclonal antibody, PBS Only 67089-1-PBS proteintech
$699.00
In stock
SKU
67089-1-PBS
| Catalog Number | 67089-1-PBS |
| Synonyms | 1D3G5, Axonin 1, AXT, Contactin2, Contactin-2 |
| Host | Mouse |
| Reactivity | human, mouse, pig |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF-P, Indirect ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Reactivity | human, mouse, pig |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag28301 Product name: Recombinant human CNTN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 865-943 aa of NM_005076 Sequence: MRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESA Predict reactive species |
| Full Name | contactin 2 (axonal) |
| Calculated Molecular Weight | 113 kDa |
| Observed Molecular Weight | 113-135 kDa |
| GenBank Accession Number | NM_005076 |
| Gene Symbol | CNTN2 |
| Gene ID (NCBI) | 6900 |
| RRID | AB_2918481 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02246 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 1D3G5 |
| Conjugation | Unconjugated |
Contactin-2 (CNTN2), also known as CNTN2 or axonal glycoprotein TAG-1, is a cell adhesion molecule anchored within the cell membrane that is a member of the immunoglobulin family. It is reported to be transiently expressed in specific neurons during the fetal period (PMID: 27621318, 29777776). CNTN2 consists of six Ig domains followed by four fibronectin domains, and it is tethered to the cell surface by a glycosylphosphatidylinositol anchor. CNTN2 levels may reflect impairment of brain development and indirectly brain iron stores, which are likely deficient in infants of maternal IDA or chronic hypoxic states like IDMs (PMID: 26718491).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
