COX6A1 Polyclonal antibody 11460-1-AP proteintech
$149.00
In stock
SKU
11460-1-AP
| Catalog Number | 11460-1-AP |
| Synonyms | COX VIa L, COX VIa-L, COX6AL, Cytochrome c oxidase polypeptide VIa-liver, Cytochrome c oxidase subunit VIA-liver |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, NIH/3T3 cells, rat liver tissue |
| Tested Applications — Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | MCF-7 cells, SH-SY5Y cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | mouse liver tissue, NIH/3T3 cells, rat liver tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells, SH-SY5Y cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2006 Product name: Recombinant human COX6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC007723 Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIa polypeptide 1 |
| Calculated Molecular Weight | 85 aa, 9 kDa |
| Observed Molecular Weight | 9.5 kDa |
| GenBank Accession Number | BC007723 |
| Gene Symbol | COX6A1 |
| Gene ID (NCBI) | 1337 |
| RRID | AB_2085445 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P12074 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for COX6A1 antibody 11460-1-AP | Download protocol |
| IHC protocol for COX6A1 antibody 11460-1-AP | Download protocol |
| WB protocol for COX6A1 antibody 11460-1-AP | Download protocol |
| mouse,human | WB,IF Autophagy PLK1 (polo like kinase 1)-dependent autophagy facilitates gefitinib-induced hepatotoxicity by degrading COX6A1 (cytochrome c oxidase subunit 6A1). Authors - Peihua Luo KD Validated View Article |
| human | WB Mol Cell Proteomics HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV Authors - Daniella H Hock View Article |
| mouse | WB Hum Mol Genet Pathological characterization of a novel mouse model expressing the PD-linked CHCHD2-T61I mutation. Authors - Teresa R Kee View Article |
| Citations | 16 |
| Dilutions | WB : 1:2000-1:12000 IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
COX6A1(Cytochrome c oxidase subunit 6A1, mitochondrial) is also named as COX6AL and belongs to the cytochrome c oxidase subunit 6A family.This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Protocols Product Specific Protocols IF protocol for COX6A1 antibody 11460-1-AP Download protocol IHC protocol for COX6A1 antibody 11460-1-AP Download protocol WB protocol for COX6A1 antibody 11460-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- PLK1 (polo like kinase 1)-dependent autophagy facilitates gefitinib-induced hepatotoxicity by degrading COX6A1 (cytochrome c oxidase subunit 6A1).
Journal: Autophagy | Authors: Peihua Luo KD Validated | Species: mouse,human | Application: WB,IF - Function of hTim8a in complex IV assembly in neuronal cells provides insight into pathomechanism underlying Mohr-Tranebjærg syndrome.
Journal: Elife | Authors: Yilin Kang | Species: human | Application: WB - O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma.
Journal: Cell Death Dis | Authors: Weicheng Wu | Species: human | Application: WB - HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV
Journal: Mol Cell Proteomics | Authors: Daniella H Hock | Species: human | Application: WB - Sex-biased zinc responses modulate ribosomal protein expression, protein synthesis and social defects in Cttnbp2 mutant mice
Journal: Neurobiol Dis | Authors: Yu-Lun Fang | Species: mouse | Application: WB - Pathological characterization of a novel mouse model expressing the PD-linked CHCHD2-T61I mutation.
Journal: Hum Mol Genet | Authors: Teresa R Kee | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
