COX6B1 Recombinant monoclonal antibody, PBS Only (Detector) 86783-1-PBS proteintech
$699.00
In stock
SKU
86783-1-PBS
| Catalog Number | 86783-1-PBS |
| Synonyms | COX VIb 1, COX VIb-1, COX6B |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag1984 Product name: Recombinant human COX6B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC001015 Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI Predict reactive species |
| Full Name | cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) |
| Calculated Molecular Weight | 80 aa, 10 kDa |
| GenBank Accession Number | BC001015 |
| Gene Symbol | COX6B1 |
| Gene ID (NCBI) | 1340 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P14854 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251743C9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
