COX6B1 Recombinant monoclonal antibody 86783-3-RR proteintech
$149.00
In stock
SKU
86783-3-RR
| Catalog Number | 86783-3-RR |
| Synonyms | COX VIb 1, COX VIb-1, COX6B |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, A549 cells, Caco-2 cells, HeLa cells, human heart tissue |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive WB detected in | HepG2 cells, A549 cells, Caco-2 cells, HeLa cells, human heart tissue |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag1984 Product name: Recombinant human COX6B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC001015 Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI Predict reactive species |
| Full Name | cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) |
| Calculated Molecular Weight | 80 aa, 10 kDa |
| Observed Molecular Weight | 10-13 kDa |
| GenBank Accession Number | BC001015 |
| Gene Symbol | COX6B1 |
| Gene ID (NCBI) | 1340 |
| RRID | AB_3745116 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P14854 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for COX6B1 antibody 86783-3-RR | Download protocol |
| WB protocol for COX6B1 antibody 86783-3-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 IF/ICC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251743G4 |
| Conjugation | Unconjugated |
COX6B1 (Cytochrome c oxidase subunit 6B1) is also named as COX6B and belongs to the cytochrome c oxidase subunit 6B family. It connects the two COX monomers into the physiological dimeric form. Defects in COX6B1 are a cause of mitochondrial complex IV deficiency (MT-C4D). Protocols Product Specific Protocols IF protocol for COX6B1 antibody 86783-3-RR Download protocol WB protocol for COX6B1 antibody 86783-3-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
