ZEB1 Monoclonal antibody 66279-1-Ig proteintech
$149.00
In stock
SKU
66279-1-Ig
| Catalog Number | 66279-1-Ig |
| Synonyms | 1H1F1, AREB6, NIL2A, NIL-2-A zinc finger protein, TCF8 |
| Host | Mouse |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, SKOV-3 cells, HepG2 cells |
| Tested Applications — Positive IF/ICC detected in | U2OS cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, SKOV-3 cells, HepG2 cells |
| Positive IF/ICC detected in | U2OS cells |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17118 Product name: Recombinant human ZEB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 391-740 aa of BC112392 Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL Predict reactive species |
| Full Name | zinc finger E-box binding homeobox 1 |
| Calculated Molecular Weight | 1125 aa, 124 kDa |
| Observed Molecular Weight | 190-210 kDa |
| GenBank Accession Number | BC112392 |
| Gene Symbol | ZEB1 |
| Gene ID (NCBI) | 6935 |
| RRID | AB_2881662 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P37275 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for ZEB1 antibody 66279-1-Ig | Download protocol |
| WB protocol for ZEB1 antibody 66279-1-Ig | Download protocol |
| human | WB J Biol Chem The aryl sulfonamide indisulam inhibits gastric cancer cell migration by promoting the ubiquitination and degradation of the transcription factor ZEB1 Authors - Jiaqi Lu View Article |
| Citations | 14 |
| Dilutions | WB : 1:1000-1:8000 IF/ICC : 1:200-1:800 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1H1F1 |
| Conjugation | Unconjugated |
ZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa. Protocols Product Specific Protocols IF protocol for ZEB1 antibody 66279-1-Ig Download protocol WB protocol for ZEB1 antibody 66279-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- FSH induces EMT in ovarian cancer via ALKBH5-regulated Snail m6A demethylation
Journal: Theranostics | Authors: Xingyan Xu | Species: human | Application: WB - The calcium pump PMCA4 prevents epithelial-mesenchymal transition by inhibiting NFATc1-ZEB1 pathway in gastric cancer.
Journal: Biochim Biophys Acta Mol Cell Res | Authors: Teng Wang | Species: human | Application: WB - Overexpression of SERPINA3 promotes tumor invasion and migration, epithelial-mesenchymal-transition in triple-negative breast cancer cells.
Journal: Breast Cancer | Authors: Yingzi Zhang | Species: human | Application: WB - A Mutation in ZNF143 as a Novel Candidate Gene for Endothelial Corneal Dystrophy.
Journal: J Clin Med | Authors: Yonggoo Kim | Species: human | Application: WB - HnRNPR promotes non-small cell lung cancer progression by protecting XB130 mRNA from XRN1- and DIS3L2-mediated degradation
Journal: Cell Signal | Authors: Qin-Rong Wang | Species: human | Application: WB - The aryl sulfonamide indisulam inhibits gastric cancer cell migration by promoting the ubiquitination and degradation of the transcription factor ZEB1
Journal: J Biol Chem | Authors: Jiaqi Lu | Species: human | Application: WB - HnRNPR promotes non-small cell lung cancer progression by protecting XB130 mRNA from XRN1- and DIS3L2-mediated degradation
Journal: Cell Signal | Authors: Qin-Rong Wang | Species: human | Application: WB - The calcium pump PMCA4 prevents epithelial-mesenchymal transition by inhibiting NFATc1-ZEB1 pathway in gastric cancer.
Journal: Biochim Biophys Acta Mol Cell Res | Authors: Teng Wang | Species: human | Application: WB - Baicalein disrupts TGF-β-induced EMT in pancreatic cancer by FTO-dependent m6A demethylation of ZEB1
Journal: Biochim Biophys Acta Mol Cell Res | Authors: Lian Zhao | Application: WB,IHC - The aryl sulfonamide indisulam inhibits gastric cancer cell migration by promoting the ubiquitination and degradation of the transcription factor ZEB1
Journal: J Biol Chem | Authors: Jiaqi Lu | Species: human | Application: WB - NFkB/RelA Signaling in Secretoglobin Progenitors Mediates Plasticity and MMP-Induced Barrier Disruption In House Dust Mite-Induced Allergic Asthma
Journal: Am J Physiol Lung Cell Mol Physiol | Authors: Melissa E Skibba | Species: mouse | Application: IF - Overexpression of SERPINA3 promotes tumor invasion and migration, epithelial-mesenchymal-transition in triple-negative breast cancer cells.
Journal: Breast Cancer | Authors: Yingzi Zhang | Species: human | Application: WB - Identification of hub genes within the CCL18 signaling pathway in hepatocellular carcinoma through bioinformatics analysis
Journal: Front Oncol | Authors: Jinlei Mao | Species: human | Application: WB - A Mutation in ZNF143 as a Novel Candidate Gene for Endothelial Corneal Dystrophy.
Journal: J Clin Med | Authors: Yonggoo Kim | Species: human | Application: WB
Reviews
Write Your Own Review