• Sign In
  • Create an Account
Toggle Nav
My Cart
Search
Advanced Search
  • Compare Products
Menu
Account

G3BP1 Polyclonal antibody 13057-2-AP proteintech

Be the first to review this product
$149.00
In stock
SKU
13057-2-AP
Add to Wish List Add to Compare
Catalog No.SizePrice (USD)
13057-2-AP-20UL20 μL$149.00
13057-2-AP-150UL150 μL$449.00
main product photo
Catalog Number13057-2-AP
SynonymsATP-dependent DNA helicase VIII, EC:3.6.4.12, G3BP, G3BP 1, G3BP-1
HostRabbit
Reactivityhuman, mouse, rat and More (5)
Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish, drosophila melanogaster (fruit fly)
FormLiquid
FormulationPBS, Azide, Glycerol
ApplicationsWB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA
ApplicationsWB, IHC, IF/ICC, FC (Intra), IP, ELISA
Host / IsotypeRabbit / IgG
Tested Applications — Positive WB detected inC6 cells, HEK-293 cells, human brain tissue, Neuro-2a cells, Jurkat cells, MCF-7 cells, HeLa cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue
Tested Applications — Positive IP detected inHEK-293 cells
Tested Applications — Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human colorectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Tested Applications — Positive IF/ICC detected insodium arsenite treated HeLa cells
Tested Applications — Positive FC (Intra) detected inHeLa cells
Recommended Dilutions — Western Blot (WB)WB : 1:2000-1:16000
Recommended Dilutions — Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Recommended Dilutions — Immunohistochemistry (IHC)IHC : 1:50-1:500
Recommended Dilutions — Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Recommended Dilutions — Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Positive WB detected inC6 cells, HEK-293 cells, human brain tissue, Neuro-2a cells, Jurkat cells, MCF-7 cells, HeLa cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human colorectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected insodium arsenite treated HeLa cells
Positive FC (Intra) detected inHeLa cells
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Tested Reactivityhuman, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish, drosophila melanogaster (fruit fly)
ClassPolyclonal
TypeAntibody
ImmunogenCatNo: Ag3728 Product name: Recombinant human G3BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-466 aa of BC006997 Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ Predict reactive species
Full NameGTPase activating protein (SH3 domain) binding protein 1
Calculated Molecular Weight466 aa, 52 kDa
Observed Molecular Weight68 kDa
GenBank Accession NumberBC006997
Gene SymbolG3BP1
Gene ID (NCBI)10146
RRIDAB_2232034
ConjugateUnconjugated
Purification MethodAntigen affinity purification
UNIPROT IDQ13283
Storage BufferPBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
FC protocol for G3BP1 antibody 13057-2-APDownload protocol
IF protocol for G3BP1 antibody 13057-2-APDownload protocol
IHC protocol for G3BP1 antibody 13057-2-APDownload protocol
IP protocol for G3BP1 antibody 13057-2-APDownload protocol
WB protocol for G3BP1 antibody 13057-2-APDownload protocol
mouse,human,chickenIF,CoIP Cell Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules Authors - Qinqin Cui View Article
humanIF Cell Phase Separation of FUS Is Suppressed by Its Nuclear Import Receptor and Arginine Methylation. Authors - Mario Hofweber View Article
Vasudevarao (Verified Customer) (04-09-2026)Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines. Applications: Western Blot, Immunofluorescence Primary Antibody Dilution: 1:1000 Cell Tissue Type: Prostate cancer cells
Prakash (Verified Customer) (10-17-2025)working very well in western blot Applications: Western Blot Primary Antibody Dilution: 1:4000 for western Cell Tissue Type: T24 Bladder cancer cell
lu (Verified Customer) (09-18-2025)Good antibody for flow cytometry Applications: Flow Cytometry Primary Antibody Dilution: 1:1000 Cell Tissue Type: OPM2
Nikolett (Verified Customer) (07-29-2025)Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human Lung Cancer Patient Derived Cell Lines
Xiaochen (Verified Customer) (11-11-2024)Applications: Immunofluorescence Cell Tissue Type: SH-SY5Y G3BP1 Antibody Immunofluorescence validation ( dilution) in SH-SY5Y (Cat no:13057-2-AP)
Roy (Verified Customer) (06-12-2024)Works great on WB (1/1000 - Overnight 4°C) - Very beautiful IF staining in non stressed (diffuse staining) and Sodium Arsenite-mediated Stress induction (Punctate staining corresponding to stress granules) in HeLa cells (1/250 - 1h at RT). Applications: Western Blot, Immunofluorescence Primary Antibody Dilution: 1/1000 Cell Tissue Type: HeLa
Vinny (Verified Customer) (02-20-2024)Good product. Applications: Immunofluorescence
Andrea (Verified Customer) (10-05-2023)Good and strong signal. Applications: Western Blot
Tatyana (Verified Customer) (01-21-2023)Used for IP and WB of GFP-tagged overexpressed human G3BP1 (HEK293 cells). Lysates were subjected to IP using GFP-Trap beads. WB was done using semi-dry transfer. Antibody was used in 4% milk in TBST at 1:1,000 dilution. It could be reused up to 3 times. As the image shows, the antibody can successfully detect both endogenous and OE protein. Applications: Immunofluorescence, Immunoprecipitation Primary Antibody Dilution: 1:1000 Cell Tissue Type: HEK293 G3BP1 Antibody Immunofluorescence,Immunoprecipitation validation (1:1000 dilution) in HEK293 (Cat no:13057-2-AP)
Tobias (Verified Customer) (10-25-2022)Applications: Western Blot
Peter (Verified Customer) (10-24-2022)Best G3BP1 antibody I've used for Western, IF and IP Applications: Western Blot, Immunofluorescence, Immunoprecipitation Primary Antibody Dilution: 1:1000 for WB. 1:200 for IF Cell Tissue Type: A549 and U2OS
Patryk (Verified Customer) (03-18-2021)I used the antibody for immunofluorescence imaging to label stress granules induced by treating the cells with with 50µM sodium arsenite. Used the antibody at a dilution 1:100 overnight at 4°C. Worked perfectly well, strong and specific signal. I am very satisfied of this antibody and strongly recommend if for immunofluorescence. Applications: Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: HCT116 cells G3BP1 Antibody Immunofluorescence validation (1:100 dilution) in HCT116 cells (Cat no:13057-2-AP)
Kun (Verified Customer) (03-23-2020)Very specific and sensitive Applications: Western Blot Primary Antibody Dilution: 1:1000
Biao (Verified Customer) (03-11-2020)This antibody is very specific and good quality. Applications: Western Blot, Cell Tissue Type: hct-116
Joshua (Verified Customer) (12-28-2019)PANC1 cells fixed in 4% paraformaldehdye. Bright localization to stress granules. Applications: Immunofluorescence, Primary Antibody Dilution: 1:500 Cell Tissue Type: human pancreatic adenocarcinoma cells G3BP1 Antibody Immunofluorescence, validation (1:500 dilution) in human pancreatic adenocarcinoma cells (Cat no:13057-2-AP)
Yuan (Verified Customer) (11-02-2019)Very bright staining for stress granule on NaAsO2 treated Hela cells. 1:500 should be sufficient for IF staining. Applications: Immunofluorescence, Primary Antibody Dilution: 1:250 Cell Tissue Type: Hela G3BP1 Antibody Immunofluorescence, validation (1:250 dilution) in Hela (Cat no:13057-2-AP)
Zeinab (Verified Customer) (08-19-2019)It worked great Applications: Immunofluorescence, Primary Antibody Dilution: 1:400
Erica (Verified Customer) (05-15-2019)Our lab has been using this antibody for IP, WB and IF for many years and it always worked well. I highly recommend this antibody, especially for IP for stress granules. Applications: Western Blot, Immunofluorescence, Immunoprecipitation, Cell Tissue Type: HeLa; MEF
Karthik (Verified Customer) (04-24-2019)Upon induction of sodium arsenite stress in neurons G3BP1 positive stress granules formed in 90 minutes.Cells permeabilized with 0.2% triton for 10 minutes Applications: Immunofluorescence, Primary Antibody Dilution: 1: 500 overnight at 4 degrees Cell Tissue Type: Primary motor neurons G3BP1 Antibody Immunofluorescence, validation (1: 500 overnight at 4 degrees dilution) in Primary motor neurons (Cat no:13057-2-AP)
Tian (Verified Customer) (01-23-2019)I used it for ICC and it worked Great. Applications: Immunofluorescence, Primary Antibody Dilution: 1;100 Cell Tissue Type: NIH3T3
Citations291
DilutionsWB : 1:2000-1:16000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:1000-1:4000 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
IsotypeIgG
ClonalityPolyclonal
Clone Number-
ConjugationUnconjugated

GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology. Protocols Product Specific Protocols FC protocol for G3BP1 antibody 13057-2-AP Download protocol IF protocol for G3BP1 antibody 13057-2-AP Download protocol IHC protocol for G3BP1 antibody 13057-2-AP Download protocol IP protocol for G3BP1 antibody 13057-2-AP Download protocol WB protocol for G3BP1 antibody 13057-2-AP Download protocol Standard Protocols Click here to view our Standard Protocols

Publications

  1. Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules
    Journal: Cell | Authors: Qinqin Cui | Species: mouse,human,chicken | Application: IF,CoIP
  2. m6A enhances the phase separation potential of mRNA.
    Journal: Nature | Authors: Ryan J Ries | Species: human | Application: IF
  3. Ubiquitination of G3BP1 mediates stress granule disassembly in a context-specific manner.
    Journal: Science | Authors: Youngdae Gwon | Species: human | Application: IP,IF
  4. ELAVL4, splicing, and glutamatergic dysfunction precede neuron loss in MAPT mutation cerebral organoids.
    Journal: Cell | Authors: Kathryn R Bowles | Species: human | Application: IF
  5. RNA Granules Hitchhike on Lysosomes for Long-Distance Transport, Using Annexin A11 as a Molecular Tether.
    Journal: Cell | Authors: Ya-Cheng Liao | Species: human | Application: IF
  6. Phase Separation of FUS Is Suppressed by Its Nuclear Import Receptor and Arginine Methylation.
    Journal: Cell | Authors: Mario Hofweber | Species: human | Application: IF
  7. Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules
    Journal: Cell | Authors: Qinqin Cui | Species: mouse,human,chicken | Application: IF,CoIP
  8. ELAVL4, splicing, and glutamatergic dysfunction precede neuron loss in MAPT mutation cerebral organoids.
    Journal: Cell | Authors: Kathryn R Bowles | Species: human | Application: IF
  9. QKI shuttles internal m7G-modified transcripts into stress granules and modulates mRNA metabolism
    Journal: Cell | Authors: Zhicong Zhao | Species: human | Application: WB,IF,CoIP
  10. RNA Granules Hitchhike on Lysosomes for Long-Distance Transport, Using Annexin A11 as a Molecular Tether.
    Journal: Cell | Authors: Ya-Cheng Liao | Species: human | Application: IF
  11. Phase Separation of FUS Is Suppressed by Its Nuclear Import Receptor and Arginine Methylation.
    Journal: Cell | Authors: Mario Hofweber | Species: human | Application: IF
  12. Polystyrene nanoparticles trigger aberrant condensation of TDP-43 and amyotrophic lateral sclerosis-like symptoms
    Journal: Nat Nanotechnol | Authors: Hang Sun | Species: human | Application: IF
  13. Virus-induced deconjugation of ISG15 dysregulates innate immunity and cellular metabolism.
    Journal: Immunity | Authors: Junji Zhu
  14. A Ubiquitination Cascade Regulating the Integrated Stress Response and Survival in Carcinomas
    Journal: Cancer Discov | Authors: Lisa D Cervia | Species: human | Application: IF
  15. Co-profiling of in situ RNA-protein interactions and transcriptome in single cells and tissues.
    Journal: Nat Methods | Authors: Qi-Xuan Cheng | Species: human | Application: WB,IP
  16. G3BP1 promotes DNA binding and activation of cGAS.
    Journal: Nat Immunol | Authors: Zhao-Shan Liu | Species: human | Application: WB
  17. LONRF2 is a protein quality control ubiquitin ligase whose deficiency causes late-onset neurological deficits
    Journal: Nat Aging | Authors: Dan Li | Species: mouse | Application: IF
  18. Biomimetic stress granules replenish lysosomal repair to reinstate macrophage immunometabolic antibacterial programs.
    Journal: Bioact Mater | Authors: Shenzhi Zhao | Species: mouse | Application: WB,IF
  19. Mammalian IRE1α dynamically and functionally coalesces with stress granules
    Journal: Nat Cell Biol | Authors: Songzi Liu | Species: human | Application: WB,IF
  20. Cyclophilin A supports translation of intrinsically disordered proteins and affects haematopoietic stem cell ageing
    Journal: Nat Cell Biol | Authors: Laure Maneix | Species: mouse | Application: IP,IF
  21. Phase separation of YAP reorganizes genome topology for long-term YAP target gene expression.
    Journal: Nat Cell Biol | Authors: Danfeng Cai | Species: human | Application: IF
  22. O-GlcNAcylation determines the translational regulation and phase separation of YTHDF proteins
    Journal: Nat Cell Biol | Authors: Yulin Chen | Species: human | Application: WB,IF
  23. SARS-CoV-2 nucleocapsid protein phase separates with G3BPs to disassemble stress granules and facilitate viral production.
    Journal: Sci Bull (Beijing) | Authors: Lingling Luo | Species: human | Application: IF
  24. Amyotrophic lateral sclerosis-linked FUS/TLS alters stress granule assembly and dynamics.
    Journal: Mol Neurodegener | Authors: Baron Desiree M DM | Species: mouse | Application: IF
  25. Stress granule homeostasis is modulated by TRIM21-mediated ubiquitination of G3BP1 and autophagy-dependent elimination of stress granules
    Journal: Autophagy | Authors: Cuiwei Yang | Species: human | Application: WB,IP,IF
  26. Stress granule assembly impairs macrophage efferocytosis to aggravate allergic rhinitis in mice.
    Journal: Nat Commun | Authors: Ye Zhou | Species: mouse | Application: IF
  27. β-propeller protein-associated neurodegeneration protein WDR45 regulates stress granule disassembly via phase separation with Caprin-1
    Journal: Nat Commun | Authors: Yin Li
  28. Time-resolved proteomic profiling reveals compositional and functional transitions across the stress granule life cycle
    Journal: Nat Commun | Authors: Shuyao Hu | Species: human | Application: WB,IF
  29. NS1 binding protein regulates stress granule dynamics and clearance by inhibiting p62 ubiquitination
    Journal: Nat Commun | Authors: Pureum Jeon | Species: human | Application: WB,IF
  30. Dysregulation of GTPase-activating protein-binding protein1 in the pathogenesis of metabolic dysfunction-associated steatotic liver disease.
    Journal: Nat Commun | Authors: Qinqin Ouyang | Species: mouse,human | Application: WB,IHC,CoIP
  31. A dual-pronged host-directed therapeutic targeting cyclophilin A and pathogenic interferon response abrogates virus-triggered pregnancy pathologies.
    Journal: Nat Commun | Authors: Wenzhe Yu
  32. Prasugrel inhibits TLR7-driven autoimmunity in systemic lupus erythematosus by acetylating cGAS.
    Journal: Nat Commun | Authors: Zeng-Lin Guo | Species: human | Application: IF
  33. NS1 binding protein regulates stress granule dynamics and clearance by inhibiting p62 ubiquitination
    Journal: Nat Commun | Authors: Pureum Jeon | Species: human | Application: WB,IF
  34. Muscleblind acts as a modifier of FUS toxicity by modulating stress granule dynamics and SMN localization.
    Journal: Nat Commun | Authors: Ian Casci | Species: Drosophila melanogaster (fruit fly) | Application: WB
  35. Time-resolved proteomic profiling reveals compositional and functional transitions across the stress granule life cycle
    Journal: Nat Commun | Authors: Shuyao Hu | Species: human | Application: WB,IF
  36. Dysregulation of GTPase-activating protein-binding protein1 in the pathogenesis of metabolic dysfunction-associated steatotic liver disease.
    Journal: Nat Commun | Authors: Qinqin Ouyang | Species: mouse,human | Application: WB,IHC,CoIP
  37. β-propeller protein-associated neurodegeneration protein WDR45 regulates stress granule disassembly via phase separation with Caprin-1
    Journal: Nat Commun | Authors: Yin Li
  38. A dual-pronged host-directed therapeutic targeting cyclophilin A and pathogenic interferon response abrogates virus-triggered pregnancy pathologies.
    Journal: Nat Commun | Authors: Wenzhe Yu
  39. RNA supply drives physiological granule assembly in neurons.
    Journal: Nat Commun | Authors: Karl E Bauer | Species: rat | Application: IF
  40. Increased G3BP2-Tau interaction in tauopathies is a natural defense against Tau aggregation
    Journal: Neuron | Authors: Congwei Wang | Species: human | Application: WB
  41. RNA Binding Antagonizes Neurotoxic Phase Transitions of TDP-43.
    Journal: Neuron | Authors: Jacob R Mann | Species: human | Application: IF
  42. YTHDF1 mitigates acute kidney injury via safeguarding m6A-methylated mRNAs in stress granules of renal tubules
    Journal: Redox Biol | Authors: Wenwen Yang | Species: mouse,human | Application: WB,IF
  43. Ribonuclease κ promotes longevity by preventing age-associated accumulation of circular RNA in stress granules.
    Journal: Mol Cell | Authors: Sieun S Kim | Species: human | Application: WB
  44. Nucleic-acid-induced ZCCHC3 condensation promotes broad innate immune responses
    Journal: Mol Cell | Authors: Miao Shi
  45. Alphaviral non-structural protein-host RBP co-condensation as a mechanism to sustain virus replication.
    Journal: Mol Cell | Authors: Yi Liu
  46. Sexually dimorphic RNA helicases DDX3X and DDX3Y differentially regulate RNA metabolism through phase separation.
    Journal: Mol Cell | Authors: Hui Shen | Species: mouse,human | Application: IF
  47. YTHDF1 differentiates the contributing roles of mTORC1 in aging
    Journal: Mol Cell | Authors: Chenzhong Xu | Species: human | Application: WB,IF
  48. ULK1 and ULK2 Regulate Stress Granule Disassembly Through Phosphorylation and Activation of VCP/p97.
    Journal: Mol Cell | Authors: Bo Wang | Species: human | Application: WB
  49. Ribonuclease κ promotes longevity by preventing age-associated accumulation of circular RNA in stress granules.
    Journal: Mol Cell | Authors: Sieun S Kim | Species: human | Application: WB
  50. Nucleic-acid-induced ZCCHC3 condensation promotes broad innate immune responses
    Journal: Mol Cell | Authors: Miao Shi
  51. O-GlcNAc modification of eIF4GI acts as a translational switch in heat shock response.
    Journal: Nat Chem Biol | Authors: Xingqian Zhang | Species: mouse | Application: WB
  52. Coronavirus S protein alters dsRNA accumulation and stress granule formation through regulation of ADAR1-p150 expression
    Journal: Nucleic Acids Res | Authors: Baochao Fan | Species: human | Application: WB,IF
  53. ZNF598 co-translationally titrates poly(GR) protein implicated in the pathogenesis of C9ORF72-associated ALS/FTD
    Journal: Nucleic Acids Res | Authors: Jumin Park | Species: human | Application: IF
  54. The pioneer round of translation ensures proper targeting of ER and mitochondrial proteins.
    Journal: Nucleic Acids Res | Authors: Joori Park | Application: WB
  55. ZNF598 co-translationally titrates poly(GR) protein implicated in the pathogenesis of C9ORF72-associated ALS/FTD
    Journal: Nucleic Acids Res | Authors: Jumin Park | Species: human | Application: IF
  56. Stress granule formation is regulated by signaling machinery involving Sch9/Ypk1, sphingolipids, and Ubi4
    Journal: Theranostics | Authors: Lihua Chen | Species: human | Application: IF
  57. C9orf72 regulates the unfolded protein response and stress granule formation by interacting with eIF2α
    Journal: Theranostics | Authors: Wenzhong Zheng | Species: human | Application: IF
  58. Hollow copper sulfide nanoparticles carrying ISRIB for the sensitized photothermal therapy of breast cancer and brain metastases through inhibiting stress granule formation and reprogramming tumor-associated macrophages
    Journal: Acta Pharm Sin B | Authors: Fan Tong | Species: mouse | Application: IF
  59. TIA1 variant drives myodegeneration in multisystem proteinopathy with SQSTM1 mutations.
    Journal: J Clin Invest | Authors: YouJin Lee | Species: human | Application: IF
  60. Prion-Like Protein LENG8-Mediated Nucleation Drives Stress Granule Assembly
    Journal: Adv Sci (Weinh) | Authors: Mingxing Zhang | Species: mouse | Application: WB,IF
  61. Perillaldehyde Improves Parkinson-Like Deficits by Targeting G3BP Mediated Stress Granule Assembly in Preclinical Models
    Journal: Adv Sci (Weinh) | Authors: Minglv Fang | Species: human | Application: WB,IP,IF
  62. Astrocytic TIA1-Mediated Stress Granules Promote the Demyelination of Optic Neuritis by Sequestering mRNA of Cholesterol Synthesis Genes in an Experimental Autoimmune Encephalomyelitis Model.
    Journal: Adv Sci (Weinh) | Authors: Zheyu Fang | Species: mouse | Application: WB,IF
  63. TIA1-Mediated Stress Granules Promote the Neuroinflammation and Demyelination in Experimental Autoimmune Encephalomyelitis through Upregulating IL-31RA Signaling
    Journal: Adv Sci (Weinh) | Authors: Xin Hua | Species: mouse | Application: IF
  64. Primate-Specific DAZ Regulates Translation of Cell Proliferation-Related mRNAs and is Essential for Maintenance of Spermatogonia
    Journal: Adv Sci (Weinh) | Authors: Ningjing Ou | Application: WB,IF
  65. G3BP1 and SLU7 Jointly Promote Immune Evasion by Downregulating MHC-I via PI3K/Akt Activation in Bladder Cancer
    Journal: Adv Sci (Weinh) | Authors: Xianchong Zheng | Species: mouse,human | Application: WB,IHC,IF
  66. ALKBH5-Mediated M6A Demethylation of G3BP1 Attenuates Ferroptosis Via Cytoplasmic Retention of YBX1/p53 in Diabetic Myocardial Ischemia-Reperfusion Injury
    Journal: Adv Sci (Weinh) | Authors: Wenyuan Li | Species: rat | Application: WB
  67. ALKBH5-Mediated M6A Demethylation of G3BP1 Attenuates Ferroptosis Via Cytoplasmic Retention of YBX1/p53 in Diabetic Myocardial Ischemia-Reperfusion Injury
    Journal: Adv Sci (Weinh) | Authors: Wenyuan Li | Species: rat | Application: WB
  68. UCHL3 Regulates Subgenomic Flaviviral RNA Condensates to Promote Virus Propagation.
    Journal: Adv Sci (Weinh) | Authors: Oscar Trejo-Cerro | Species: human | Application: WB
  69. High-throughput tagging of endogenous loci for rapid characterization of protein function
    Journal: Sci Adv | Authors: Joonwon Kim | Species: human | Application: IF
  70. Endogenous retrovirus-like proteins recruit UBQLN2 to stress granules and shape their functional biology
    Journal: Sci Adv | Authors: Harihar M Mohan | Species: human | Application: WB
  71. RNA G-quadruplex organizes stress granule assembly through DNAPTP6 in neurons
    Journal: Sci Adv | Authors: Sefan Asamitsu | Species: mouse | Application: IF
  72. Translation landscape of stress granules.
    Journal: Sci Adv | Authors: Yichun Wu | Species: human | Application: WB
  73. Metabolic traits shape responses to LSD1-directed therapy in glioblastoma tumor-initiating cells
    Journal: Sci Adv | Authors: Giulia Marotta | Species: zebrafish | Application: IF
  74. Dysregulation of autophagy and stress granule-related proteins in stress-driven Tau pathology.
    Journal: Cell Death Differ | Authors: Joana Margarida Silva | Species: human | Application: WB,IF
  75. ISR inhibition reverses pancreatic β-cell failure in Wolfram syndrome models
    Journal: Cell Death Differ | Authors: Rui Hu | Species: mouse | Application: IF
  76. Angiogenin-mediated tsRNAs control inflammation and metabolic disorder by regulating NLRP3 inflammasome
    Journal: Cell Death Differ | Authors: Jiangxue Cai | Species: mouse | Application: IF
  77. TIA1-mediated stress granules promote neurodegeneration by sequestering HSP70 mRNA in C9orf72 mice
    Journal: Brain | Authors: Yan Wei | Species: mouse | Application: WB,IF
  78. STMN2 protein depletion via translation deficits and stress granules in amyotrophic lateral sclerosis.
    Journal: Brain | Authors: Brittany C. S. Ellis
  79. TIA1-mediated stress granules promote neurodegeneration by sequestering HSP70 mRNA in C9orf72 mice
    Journal: Brain | Authors: Yan Wei | Species: mouse | Application: WB,IF
  80. Mislocated FUS is sufficient for gain-of-toxic-function amyotrophic lateral sclerosis phenotypes in mice.
    Journal: Brain | Authors: Gen Shiihashi | Species: mouse | Application: IF
  81. Multiple lines of evidence for disruption of nuclear lamina and nucleoporins in FUS amyotrophic lateral sclerosis
    Journal: Brain | Authors: Kensuke Okada | Species: mouse | Application: IHC
  82. Plumbagin ameliorates multiple sclerosis by inducing DDX3X-mediated stress granule assembly in mice.
    Journal: Pharmacol Res | Authors: Minglv Fang | Species: mouse,human | Application: IF
  83. Proximity proteomics reveals OTUD6B regulation of stress granule dynamics through coalescence with VCP/p97.
    Journal: Cell Death Dis | Authors: Dian Yang | Species: human | Application: IF
  84. c-Myc-activated USP2-AS1 suppresses senescence and promotes tumor progression via stabilization of E2F1 mRNA
    Journal: Cell Death Dis | Authors: Bingyan Li | Species: human | Application: WB,RIP
  85. Proximity proteomics reveals OTUD6B regulation of stress granule dynamics through coalescence with VCP/p97.
    Journal: Cell Death Dis | Authors: Dian Yang | Species: human | Application: IF
  86. c-Myc-activated USP2-AS1 suppresses senescence and promotes tumor progression via stabilization of E2F1 mRNA
    Journal: Cell Death Dis | Authors: Bingyan Li | Species: human | Application: WB,RIP
  87. USP5 regulates purine metabolism and represents a therapeutic target in esophageal cancer.
    Journal: Cell Death Dis | Authors: Kexin Zhao | Species: human | Application: WB
  88. In Vivo Screening Unveils Pervasive RNA-Binding Protein Dependencies in Leukemic Stem Cells and Identifies ELAVL1 as a Therapeutic Target
    Journal: Blood Cancer Discov | Authors: Ana Vujovic | Species: human | Application: IF
  89. Hypoxia-driven phase separation of the PABP1/eIF4B complex forms stress granules and activates ChaC2 translation to promote polyunsaturated lipids-supported peritoneal metastasis in gastric cancer.
    Journal: Cancer Lett | Authors: Zaihuan Lin | Species: human | Application: WB
  90. Endometrial cancer (EC) derived G3BP1 overexpression and mutant promote EC tumorigenesis and metastasis via SPOP/ERα axis
    Journal: Cell Commun Signal | Authors: Yidong Ge | Species: human | Application: WB,IHC,CoIP
  91. Endometrial cancer (EC) derived G3BP1 overexpression and mutant promote EC tumorigenesis and metastasis via SPOP/ERα axis
    Journal: Cell Commun Signal | Authors: Yidong Ge | Species: human | Application: WB,IHC,CoIP
  92. Tannic acid inhibits viral replication by disrupting nucleocapsid condensation.
    Journal: Phytomedicine | Authors: Jie Pan | Species: human | Application: WB
  93. G3BP1 maintains endothelial barrier integrity through dual mechanisms: direct stabilization of junction protein mRNAs and suppression of the inflammatory MYD88-ARNO-ARF6 pathway.
    Journal: Angiogenesis | Authors: Weiyue Sun | Species: mouse | Application: IF
  94. NSCLC cells sustain phase separation of cytoplasmic membrane-less organelles to protect themselves against cisplatin treatment
    Journal: Acta Pharmacol Sin | Authors: Ning-Ning Li | Species: human | Application: WB,IF
  95. CircEIF3H-IGF2BP2-HuR scaffold complex promotes TNBC progression via stabilizing HSPD1/RBM8A/G3BP1 mRNA.
    Journal: Cell Death Discov | Authors: Xiaojin Song | Species: human | Application: WB
  96. Loss of PML nuclear bodies in familial amyotrophic lateral sclerosis-frontotemporal dementia
    Journal: Cell Death Discov | Authors: Francesco Antoniani | Species: human | Application: IF
  97. Loss of PML nuclear bodies in familial amyotrophic lateral sclerosis-frontotemporal dementia
    Journal: Cell Death Discov | Authors: Francesco Antoniani | Species: human | Application: IF
  98. Induction of stress granules alleviates programmed cell death induced by lysosomal damage during NK cell cryopreservation.
    Journal: Cell Death Discov | Authors: Yang Liu | Species: human | Application: IF
  99. Annexin A11 aggregation in FTLD-TDP type C and related neurodegenerative disease proteinopathies
    Journal: Acta Neuropathol | Authors: John L Robinson | Species: human | Application: IHC
  100. DDX17 is involved in DNA damage repair and modifies FUS toxicity in an RGG-domain dependent manner.
    Journal: Acta Neuropathol | Authors: Tyler R Fortuna | Species: human | Application: IF
  101. ALS mutant SOD1 interacts with G3BP1 and affects stress granule dynamics.
    Journal: Acta Neuropathol | Authors: Jozsef Gal | Species: mouse,human | Application: WB,IF
  102. Pur-alpha regulates cytoplasmic stress granule dynamics and ameliorates FUS toxicity.
    Journal: Acta Neuropathol | Authors: J Gavin Daigle | Species: human | Application: IF
  103. Cereblon induces G3BP2 neosubstrate degradation using molecular surface mimicry.
    Journal: Nat Struct Mol Biol | Authors: Stefano Annunziato | Species: human | Application: WB
  104. TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.
    Journal: Nat Struct Mol Biol | Authors: Xinxin Zuo | Species: mouse | Application: WB
  105. Hypoxia-induced PRMT6 expression promotes temozolomide chemoresistance in glioblastoma via G3BP1.
    Journal: J Transl Med | Authors: Shuyang Chen | Species: mouse,human | Application: WB,RIP,IP,IHC,IF
  106. Age-Associated Activation of the cGAS-STING Pathway and Impairment of DNA Damage Repair in Human Primary Alveolar Type II Cells
    Journal: Aging Dis | Authors: Chih-Ru Lin | Species: Human
  107. Stress granule-mediated ZBP1 activation drives necroptotic cell death in non-obstructive azoospermia and testicular aging
    Journal: Proc Natl Acad Sci U S A | Authors: Hongen Lei | Species: mouse,human | Application: WB,IHC,IF
  108. Viral evasion of PKR restriction by reprogramming cellular stress granules.
    Journal: Proc Natl Acad Sci U S A | Authors: Peng Gao | Species: human | Application: WB
  109. Deregulation of ER-mitochondria contact formation and mitochondrial calcium homeostasis mediated by VDAC in fragile X syndrome
    Journal: Dev Cell | Authors: Ji Geng | Species: human | Application: WB
  110. Stress granules promote DNA damage repair through the G3BP1/NAT10/ATF3 axis to facilitate nasopharyngeal carcinoma progression.
    Journal: Oncogene | Authors: Tian Yue | Species: human | Application: WB,IF
  111. circIPO7 dissociates caprin-1 from ribosomes and inhibits gastric cancer cell proliferation by suppressing EGFR and mTOR
    Journal: Oncogene | Authors: Jing Liu | Species: human | Application: WB,CoIP
  112. Effect of P53 nuclear localization mediated by G3BP1 on ferroptosis in acute liver failure
    Journal: Apoptosis | Authors: Wenyuan Li | Species: human | Application: WB
  113. Zinc enhances liquid-liquid phase separation of Tau protein and aggravates mitochondrial damages in cells.
    Journal: Int J Biol Macromol | Authors: Ying-Ying Gao | Species: human | Application: WB,IP,IF
  114. Disease-linked TDP-43 hyperphosphorylation suppresses TDP-43 condensation and aggregation.
    Journal: EMBO J | Authors: Lara A Gruijs da Silva | Species: human | Application: IF
  115. Advanced oxidation protein products exacerbate osteoarthritis progression by disrupting stress granules assembly via endoplasmic reticulum stress.
    Journal: Free Radic Biol Med | Authors: Weihao Jiang | Species: mouse | Application: WB,IF,CoIP
  116. MCT4-mediated lactate efflux promotes STING-dependent dendritic cell antitumor immunity.
    Journal: Cell Rep | Authors: Rui Ding
  117. IGF2BP2 promotes malignant progression of ovarian cancer by regulating protein synthesis through liquid-liquid phase separation.
    Journal: Cell Rep | Authors: Xueyou Xiong | Species: human | Application: IF
  118. Stress granule-localized USP8 potentiates cGAS-mediated type I interferonopathies through deubiquitination of DDX3X
    Journal: Cell Rep | Authors: Xuejing Zhang | Species: human | Application: IF
  119. The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation
    Journal: Cell Rep | Authors: Nicolas Curdy | Species: mouse | Application: WB,IP,IF
  120. Stress granule formation inhibits stress-induced apoptosis by selectively sequestering executioner caspases
    Journal: Curr Biol | Authors: Daichi Fujikawa | Species: human | Application: WB
  121. Microtubule-Driven Stress Granule Dynamics Regulate Inhibitory Immune Checkpoint Expression in T Cells.
    Journal: Cell Rep | Authors: Don-Marc Franchini | Species: human | Application: WB,CoIP
  122. Stress granule-localized USP8 potentiates cGAS-mediated type I interferonopathies through deubiquitination of DDX3X
    Journal: Cell Rep | Authors: Xuejing Zhang | Species: human | Application: IF
  123. Neurons and astrocytes have distinct organelle signatures and responses to stress.
    Journal: Cell Rep | Authors: Shannon N. Rhoads | Species: rat | Application: IF
  124. Interaction between host G3BP and viral nucleocapsid protein regulates SARS-CoV-2 replication and pathogenicity
    Journal: Cell Rep | Authors: Zemin Yang | Species: monkey | Application: IHC
  125. Stress granule formation inhibits stress-induced apoptosis by selectively sequestering executioner caspases
    Journal: Curr Biol | Authors: Daichi Fujikawa | Species: human | Application: WB
  126. SARS-CoV-2 directly infects the inner ear and causes hearing dysfunction.
    Journal: Cell Rep | Authors: Xiaozhou Liu | Species: mouse | Application: IF
  127. The Protein Arginine Methyltransferase PRMT8 and Substrate G3BP1 Control Rac1-PAK1 Signaling and Actin Cytoskeleton for Dendritic Spine Maturation.
    Journal: Cell Rep | Authors: Louisa Hoi-Ying Lo | Species: rat | Application: WB,IF
  128. Liquid-liquid phase separation of ATXN2L enhances mRNA translation in hepatocellular carcinoma.
    Journal: Cell Rep | Authors: Shenghong Wang | Species: rat,mouse,human | Application: WB,RIP,IP,IHC,IF,CoIP
  129. Triggering endogenous Z-RNA sensing for anti-tumor therapy through ZBP1-dependent necroptosis
    Journal: Cell Rep | Authors: Tao Yang | Species: human | Application: WB,IP
  130. Microtubule-Driven Stress Granule Dynamics Regulate Inhibitory Immune Checkpoint Expression in T Cells.
    Journal: Cell Rep | Authors: Don-Marc Franchini | Species: human | Application: WB,CoIP
  131. Neurons and astrocytes have distinct organelle signatures and responses to stress.
    Journal: Cell Rep | Authors: Shannon N. Rhoads | Species: rat | Application: IF
  132. Interaction between host G3BP and viral nucleocapsid protein regulates SARS-CoV-2 replication and pathogenicity
    Journal: Cell Rep | Authors: Zemin Yang | Species: monkey | Application: IHC
  133. Loss of C9orf72 perturbs the Ran-GTPase gradient and nucleocytoplasmic transport, generating compositionally diverse Importin β-1 granules
    Journal: Cell Rep | Authors: Philip McGoldrick | Species: mouse | Application: IF
  134. IGF2BP2 promotes malignant progression of ovarian cancer by regulating protein synthesis through liquid-liquid phase separation.
    Journal: Cell Rep | Authors: Xueyou Xiong | Species: human | Application: IF
  135. ZYG11B potentiates the antiviral innate immune response by enhancing cGAS-DNA binding and condensation
    Journal: Cell Rep | Authors: Jie Zhang | Species: human | Application: WB,CoIP
  136. Nuclear transport impairment of amyotrophic lateral sclerosis-linked mutations in FUS/TLS.
    Journal: Ann Neurol | Authors: Ito Daisuke D | Species: human | Application: IF
  137. Impaired Restoration of Global Protein Synthesis Contributes to Increased Vulnerability to Acute ER Stress Recovery in Huntington's Disease.
    Journal: Cell Mol Neurobiol | Authors: Hongyuan Xu | Species: mouse | Application: IF
  138. ALS/FTD-associated protein FUS induces mitochondrial dysfunction by preferentially sequestering respiratory chain complex mRNAs.
    Journal: Genes Dev | Authors: Yueh-Lin Tsai | Species: human | Application: IF
  139. Molecular Graph-Based Deep Learning Algorithm Facilitates an Imaging-Based Strategy for Rapid Discovery of Small Molecules Modulating Biomolecular Condensates
    Journal: J Med Chem | Authors: Peng Gao | Species: human | Application: IF
  140. Screening Linear and Circular RNA Transcripts from Stress Granules.
    Journal: Genomics Proteomics Bioinformatics | Authors: Shuai Chen | Species: human | Application: WB
  141. Stress Granules Play a Critical Role in Hexavalent Chromium-Induced Malignancy in a G3BP1 Dependent Manner
    Journal: Environ Pollut | Authors: Brian Shaw | Species: human | Application: WB,IF
  142. Canonical cellular stress granules are required for arsenite-induced necroptosis mediated by Z-DNA-binding protein 1
    Journal: Sci Signal | Authors: Mateusz Szczerba | Species: mouse,human | Application: WB,IF
  143. PKR-dependent cytosolic cGAS foci are necessary for intracellular DNA sensing.
    Journal: Sci Signal | Authors: Siqi Hu | Species: human | Application: WB,IF
  144. Stress granules affect the dual PI3K/mTOR inhibitor response by regulating the mitochondrial unfolded protein response
    Journal: Cancer Cell Int | Authors: Nan Lin | Species: human | Application: WB,IP,IF
  145. Polyphosphate modulates the stress-responsive formation of functional RNA-protein condensates in bacteria and mammalian cells.
    Journal: PLoS Biol | Authors: Jian Guan | Species: human | Application: IF
  146. LSM12-EPAC1 defines a neuroprotective pathway that sustains the nucleocytoplasmic RAN gradient.
    Journal: PLoS Biol | Authors: Jongbo Lee | Species: human | Application: IF
  147. Huashi Baidu granules alleviates LPS-induced acute lung injury by targeting TACE-mediated inflammatory signaling and stress granules disassembly
    Journal: J Ethnopharmacol | Authors: Yuman Ma | Application: WB
  148. Senecavirus a can replicate in apical-out porcine intestinal organoids and induce stress granules and innate immune response
    Journal: Virulence | Authors: Ying Wang
  149. A novel stroke rehabilitation strategy and underlying stress granule regulations through inhibition of NLRP3 inflammasome activation
    Journal: CNS Neurosci Ther | Authors: Qingzhu Wang | Species: rat | Application: WB,IF,CoIP
  150. cGAS inhibition alleviates Alu RNA-induced immune responses and cytotoxicity in retinal pigmented epithelium.
    Journal: Cell Biosci | Authors: Jing Li | Species: human | Application: WB
  151. TIA1-mediated stress granules inhibit the neuroinflammation and neurodegeneration after spinal cord injury through LCN2 signaling.
    Journal: Cell Mol Life Sci | Authors: Mengxian Jia | Species: mouse | Application: WB,IF
  152. cGAS inhibition alleviates Alu RNA-induced immune responses and cytotoxicity in retinal pigmented epithelium.
    Journal: Cell Biosci | Authors: Jing Li | Species: human | Application: WB
  153. Aggregation-prone TDP-43 sequesters and drives pathological transitions of free nuclear TDP-43
    Journal: Cell Mol Life Sci | Authors: Sean S Keating | Species: human | Application: IF
  154. Apurinic/apyrimidinic endodeoxyribonuclease 1 (APE1) promotes stress granule formation via YBX1 phosphorylation in ovarian cancer
    Journal: Cell Mol Life Sci | Authors: Shuyu Mao | Species: human | Application: WB,IF
  155. Tumor-promoting properties of karyopherin β1 in melanoma by stabilizing Ras-GTPase-activating protein SH3 domain-binding protein 1.
    Journal: Cancer Gene Ther | Authors: Fan Yang | Species: human | Application: IF
  156. G3BP1, a stress granule core protein, ameliorates metabolic dysfunction-associated fatty liver disease by attenuating hepatocyte lipid deposition
    Journal: Diabetes Obes Metab | Authors: Xingjing Liu | Species: human | Application: WB,IF
  157. G3BP1, a stress granule core protein, ameliorates metabolic dysfunction-associated fatty liver disease by attenuating hepatocyte lipid deposition
    Journal: Diabetes Obes Metab | Authors: Xingjing Liu | Species: human | Application: WB,IF
  158. RACK1 MARylation regulates translation and stress granules in ovarian cancer cells
    Journal: J Cell Biol | Authors: Sridevi Challa | Species: human | Application: WB,IP,IF
  159. LLPS of FXR proteins drives replication organelle clustering for β-coronaviral proliferation
    Journal: J Cell Biol | Authors: Meng Li | Species: human | Application: IF
  160. EPHA2/CD44-directed trafficking enhances endosomal leakiness and antisense therapy delivery.
    Journal: J Cell Biol | Authors: Sergi Marco
  161. Stress Granule Assembly in Pulmonary Arterial Hypertension
    Journal: Cells | Authors: Kosmas Kosmas | Species: rat | Application: WB,IF
  162. c-Abl Regulates the Pathological Deposition of TDP-43 via Tyrosine 43 Phosphorylation
    Journal: Cells | Authors: Saebom Lee | Species: human | Application: IF
  163. Stress granules are not present in Kras mutant cancers and do not control tumor growth
    Journal: EMBO Rep | Authors: Maxime Libert | Species: human | Application: WB
  164. Stress Granule Assembly in Pulmonary Arterial Hypertension
    Journal: Cells | Authors: Kosmas Kosmas | Species: rat | Application: WB,IF
  165. c-Abl Regulates the Pathological Deposition of TDP-43 via Tyrosine 43 Phosphorylation
    Journal: Cells | Authors: Saebom Lee | Species: human | Application: IF
  166. Diagnostic and prognostic values of PBMC proteins in amyotrophic lateral sclerosis.
    Journal: Neurobiol Dis | Authors: Silvia Luotti | Species: human | Application: WB
  167. UBXN1 maintains ER proteostasis and represses UPR activation by modulating translation
    Journal: EMBO Rep | Authors: Brittany A Ahlstedt | Species: human | Application: WB
  168. ALS-linked KIF5A ΔExon27 mutant causes neuronal toxicity through gain-of-function.
    Journal: EMBO Rep | Authors: Devesh C Pant | Species: human | Application: IF
  169. African swine fever virus RNA polymerase subunits C315R and H359L inhibition host translation by activating the PKR-eIF2a pathway and suppression inflammatory responses
    Journal: Front Microbiol | Authors: Saixia Yang | Species: pig | Application: WB
  170. Resveratrol offers therapeutic potential in obesity-related osteoarthritis by targeting ferroptosis via G3BP1-SGs/mTOR modulation.
    Journal: Commun Biol | Authors: Jianyi He
  171. Infection with novel duck reovirus induces stress granule and methylation-mediated host translational shutoff in Muscovy ducklings
    Journal: Commun Biol | Authors: Tao Yun | Application: WB,RIP,IP,IF
  172. HDAC6, A Novel Cargo for Autophagic Clearance of Stress Granules, Mediates the Repression of the Type I Interferon Response During Coxsackievirus A16 Infection.
    Journal: Front Microbiol | Authors: Yingcheng Zheng | Species: human | Application: WB,IF
  173. Pre-treatment with baicalein alleviates the diquat-induced microglial pyroptosis through gut microbiota-derived indole-3-propionic acid and DDX3X/G3BP1 pathway.
    Journal: Cell Biol Toxicol | Authors: Ting Li | Species: mouse | Application: WB
  174. Post-Transcriptional Regulation of Alpha One Antitrypsin by a Proteasome Inhibitor.
    Journal: Int J Mol Sci | Authors: Lang Rao | Species: human | Application: WB
  175. Dynamic proximity interaction profiling suggests that YPEL2 is involved in cellular stress surveillance
    Journal: Protein Sci | Authors: Gizem Turan | Species: human | Application: IF
  176. Post-Transcriptional Regulation of Alpha One Antitrypsin by a Proteasome Inhibitor.
    Journal: Int J Mol Sci | Authors: Lang Rao | Species: human | Application: WB
  177. The neuroprotective effect of Cucurbitacin B against Aβ and tau toxicities requires functional HDAC6 and stress granule pathways.
    Journal: Biogerontology | Authors: Xiaohui Tu | Species: human | Application: IF
  178. Rapid prediction of drug inhibition under heat stress: single-photon imaging combined with a convolutional neural network.
    Journal: Nanoscale | Authors: Hongxin Lin | Species: human | Application: IF
  179. Quantitative Analysis of Plasmid DNA Distribution and Transgene Expression Following Cell Squeezing.
    Journal: Ann Biomed Eng | Authors: Justin Sylvers
  180. Glycation modulates superoxide dismutase 1 aggregation and toxicity in models of sporadic amyotrophic lateral sclerosis
    Journal: Biochim Biophys Acta Mol Basis Dis | Authors: José R Monteiro Neto | Species: human | Application: IF
  181. Glycation modulates superoxide dismutase 1 aggregation and toxicity in models of sporadic amyotrophic lateral sclerosis
    Journal: Biochim Biophys Acta Mol Basis Dis | Authors: José R Monteiro Neto | Species: human | Application: IF
  182. Protective role of Angiogenin in muscle regeneration in amyotrophic lateral sclerosis: Diagnostic and therapeutic implications
    Journal: Brain Pathol | Authors: Paola Fabbrizio | Species: mouse | Application: WB
  183. The Myoblast C2C12 Transfected with Mutant Valosin-Containing Protein Exhibits Delayed Stress Granule Resolution on Oxidative Stress.
    Journal: Am J Pathol | Authors: Carlos J Rodriguez-Ortiz | Species: mouse | Application: WB,IHC,IF
  184. Differential assembly of RNP granules via activation of distinct dsRNA sensors by adenovirus mutants.
    Journal: PLoS Pathog | Authors: Robert T. Steinbock
  185. De novo design of RNA-binding proteins with a prion-like domain related to ALS/FTD proteinopathies.
    Journal: Sci Rep | Authors: Kana Mitsuhashi | Species: human | Application: IF
  186. Nuclear RNA transcript levels modulate nucleocytoplasmic distribution of ALS/FTD-associated protein FUS.
    Journal: Sci Rep | Authors: Yueh-Lin Tsai | Species: human | Application: IF
  187. Downregulation of Lnc-ABCA12-3 modulates UBQLN1 expression and protein homeostasis pathways in amyotrophic lateral sclerosis
    Journal: Sci Rep | Authors: Yujiao Yu | Species: human | Application: IF
  188. Nuclear RNA transcript levels modulate nucleocytoplasmic distribution of ALS/FTD-associated protein FUS.
    Journal: Sci Rep | Authors: Yueh-Lin Tsai | Species: human | Application: IF
  189. The Myoblast C2C12 Transfected with Mutant Valosin-Containing Protein Exhibits Delayed Stress Granule Resolution on Oxidative Stress.
    Journal: Am J Pathol | Authors: Carlos J Rodriguez-Ortiz | Species: mouse | Application: WB,IHC,IF
  190. Differential assembly of RNP granules via activation of distinct dsRNA sensors by adenovirus mutants.
    Journal: PLoS Pathog | Authors: Robert T. Steinbock
  191. Modulating inflammasome (NLRP3) activation and stress granule (SG) formation: Insight of neuroprotection by Normobaric oxygen (NBO) in ischemic stroke.
    Journal: Exp Neurol | Authors: Sichao Guo
  192. The antiviral role of TRIM25 in mammalian embryonic stem cells.
    Journal: Virol Sin | Authors: Jie Zou
  193. Translatable Circular RNAs are Degraded Via Nonsense-mediated mRNA Decay.
    Journal: J Mol Biol | Authors: Eunchae Kang | Species: human | Application: WB
  194. Genome-Wide Impact of Human DBR1 Depletion on RNA Processing Networks Reveal a Connection Between Pre-mRNA Splicing, mRNA Surveillance and Stress Granule Dynamics.
    Journal: J Mol Biol | Authors: Tiffany Barwell
  195. Mutational burden of XPNPEP3 leads to defects in mitochondrial complex I and cilia in NPHPL1
    Journal: iScience | Authors: Lingxiao Tong | Species: human | Application: WB
  196. Missing in Action: Dysfunctional RNA Metabolism in Oligodendroglial Cells as a Contributor to Neurodegenerative Diseases?
    Journal: Neurochem Res | Authors: Peter Hoch-Kraft | Application: IF
  197. Cdh1-APC Regulates Protein Synthesis and Stress Granules in Neurons through an FMRP-Dependent Mechanism.
    Journal: iScience | Authors: Arielle N Valdez-Sinon | Species: mouse | Application: WB,IF
  198. Differential toxicity and localization of arginine-rich C9ORF72 dipeptide repeat proteins depend on de-clustering of positive charges
    Journal: iScience | Authors: Tamami Miyagi | Species: human | Application: WB
  199. Cdh1-APC Regulates Protein Synthesis and Stress Granules in Neurons through an FMRP-Dependent Mechanism.
    Journal: iScience | Authors: Arielle N Valdez-Sinon | Species: mouse | Application: WB,IF
  200. Endoplasmic Reticulum Stress Signalling Induces Casein Kinase 1-Dependent Formation of Cytosolic TDP-43 Inclusions in Motor Neuron-Like Cells.
    Journal: Neurochem Res | Authors: David A Hicks | Species: mouse | Application: WB,IF
  201. Differential toxicity and localization of arginine-rich C9ORF72 dipeptide repeat proteins depend on de-clustering of positive charges
    Journal: iScience | Authors: Tamami Miyagi | Species: human | Application: WB
  202. Missing in Action: Dysfunctional RNA Metabolism in Oligodendroglial Cells as a Contributor to Neurodegenerative Diseases?
    Journal: Neurochem Res | Authors: Peter Hoch-Kraft | Application: IF
  203. C9orf72 poly-PR forms anisotropic condensates causative of nuclear TDP-43 pathology
    Journal: iScience | Authors: Rachel E Hodgson | Species: human | Application: IF
  204. Mutational burden of XPNPEP3 leads to defects in mitochondrial complex I and cilia in NPHPL1
    Journal: iScience | Authors: Lingxiao Tong | Species: human | Application: WB
  205. Phosphorylation Regulates CIRBP Arginine Methylation, Transportin-1 Binding and Liquid-Liquid Phase Separation.
    Journal: Front Mol Biosci | Authors: Aneta J Lenard | Species: human | Application: IF
  206. Neuronal models of TDP-43 proteinopathy display reduced axonal translation, increased oxidative stress, and defective exocytosis
    Journal: Front Cell Neurosci | Authors: Alessandra Pisciottani | Species: mouse | Application: IF
  207. ADAR1 upregulates the translation of cytochrome c via the inhibition of translocation into stress granules, facilitating apoptosis by an anticancer agent.
    Journal: Biochim Biophys Acta Mol Cell Res | Authors: Motoki Isono | Species: human | Application: IF
  208. Proteomic analysis identifies the RNA helicase DDX3X as a host target against SARS-CoV-2 infection.
    Journal: Antiviral Res | Authors: Fabiola Ciccosanti | Species: monkey | Application: IP,IF
  209. STAU1 binds to IBDV genomic double-stranded RNA and promotes viral replication via attenuation of MDA5-dependent β interferon induction.
    Journal: FASEB J | Authors: Chengjin Ye
  210. Histone deacetylase 11 regulates stress granule formation to promote endothelial-to-mesenchymal transition in atherosclerosis.
    Journal: Biochim Biophys Acta Mol Cell Res | Authors: Lingxuan Ren
  211. The SAMHD1-mediated block of LINE-1 retroelements is regulated by phosphorylation.
    Journal: Mob DNA | Authors: Alexandra Herrmann | Species: human | Application: IF
  212. Melatonin Offers Dual-Phase Protection to Brain Vessel Endothelial Cells in Prolonged Cerebral Ischemia-Recanalization Through Ameliorating ER Stress and Resolving Refractory Stress Granule
    Journal: Transl Stroke Res | Authors: Danli Lu | Species: mouse | Application: WB,IP
  213. The G3BP1-UPF1-Associated Long Non-Coding RNA CALA Regulates RNA Turnover in the Cytoplasm.
    Journal: Noncoding RNA | Authors: Luisa Kirchhof | Species: human | Application: WB,RIP,IP
  214. The RNA-binding protein FUS/TLS undergoes calcium-mediated nuclear egress during excitotoxic stress and is required for GRIA2 mRNA processing.
    Journal: J Biol Chem | Authors: Maeve Tischbein | Species: mouse | Application: IF
  215. Orf virus ORF120 protein positively regulates the NF-κB pathway by interacting with G3BP1.
    Journal: J Virol | Authors: Yanlong Zhou | Species: Human | Application: WB
  216. Abnormal regulation of membrane-less organelles contributes to profilin1-associated ALS
    Journal: J Biol Chem | Authors: Guoqiang Ma | Application: WB,IF
  217. Regulation of TAR DNA binding protein 43 (TDP-43) homeostasis by cytosolic DNA accumulation
    Journal: J Biol Chem | Authors: Cha Yang | Species: mouse | Application: IF
  218. Proximity-based labeling reveals DNA damage-induced phosphorylation of fused in sarcoma (FUS) causes distinct changes in the FUS protein interactome
    Journal: J Biol Chem | Authors: Michelle A Johnson | Species: human | Application: WB,IF
  219. Roles of ataxin-2 in pathological cascades mediated by TAR DNA-binding protein 43 (TDP-43) and Fused in Sarcoma (FUS).
    Journal: J Biol Chem | Authors: Nihei Yoshihiro Y | Species: human | Application: IF
  220. Defining the role of stress granules in innate immune suppression by the HSV-1 endoribonuclease VHS.
    Journal: J Virol | Authors: Hannah M Burgess | Species: human | Application: WB,IF
  221. African swine fever virus pS273R antagonizes stress granule formation by cleaving the nucleating protein G3BP1 to facilitate viral replication
    Journal: J Biol Chem | Authors: Tingting Li | Species: pig | Application: WB,IF
  222. Typical Stress Granule Proteins Interact with the 3' Untranslated Region of Enterovirus D68 To Inhibit Viral Replication.
    Journal: J Virol | Authors: Jinyan Cheng | Species: human | Application: WB,IF
  223. Orf virus ORF120 protein positively regulates the NF-κB pathway by interacting with G3BP1.
    Journal: J Virol | Authors: Yanlong Zhou | Species: Human | Application: WB
  224. The SHFV nsp2 and nucleocapsid proteins recruit G3BP1 to sites of viral replication, but stress granules are not induced by the infection
    Journal: J Virol | Authors: Ayisha A Lavender | Species: monkey | Application: IF,CoIP
  225. A GTPase-activating protein binding protein (G3BP1) / antiviral protein relay conveys arteriosclerotic Wnt signals in aortic smooth muscle cells.
    Journal: J Biol Chem | Authors: Bindu Ramachandran | Species: mouse | Application: IHC,IF
  226. The RNA-binding protein FUS/TLS undergoes calcium-mediated nuclear egress during excitotoxic stress and is required for GRIA2 mRNA processing.
    Journal: J Biol Chem | Authors: Maeve Tischbein | Species: mouse | Application: IF
  227. Proximity-based labeling reveals DNA damage-induced phosphorylation of fused in sarcoma (FUS) causes distinct changes in the FUS protein interactome
    Journal: J Biol Chem | Authors: Michelle A Johnson | Species: human | Application: WB,IF
  228. West Nile virus and Zika virus infections induce aggresome formation in human neural progenitor and A549 cells.
    Journal: J Virol | Authors: Mausumi Basu | Species: human | Application: IF
  229. The RNA-binding protein FUS/TLS undergoes calcium-mediated nuclear egress during excitotoxic stress and is required for GRIA2 mRNA processing.
    Journal: J Biol Chem | Authors: Maeve Tischbein | Species: mouse | Application: IF
  230. Characterization of alternative isoforms and inclusion body of the TAR DNA-binding protein-43.
    Journal: J Biol Chem | Authors: Nishimoto Yoshinori Y | Species: mouse,human | Application: WB,IF
  231. Abnormal regulation of membrane-less organelles contributes to profilin1-associated ALS
    Journal: J Biol Chem | Authors: Guoqiang Ma | Application: WB,IF
  232. Roles of ataxin-2 in pathological cascades mediated by TAR DNA-binding protein 43 (TDP-43) and Fused in Sarcoma (FUS).
    Journal: J Biol Chem | Authors: Nihei Yoshihiro Y | Species: human | Application: IF
  233. Typical Stress Granule Proteins Interact with the 3' Untranslated Region of Enterovirus D68 To Inhibit Viral Replication.
    Journal: J Virol | Authors: Jinyan Cheng | Species: human | Application: WB,IF
  234. Regulation of TAR DNA binding protein 43 (TDP-43) homeostasis by cytosolic DNA accumulation
    Journal: J Biol Chem | Authors: Cha Yang | Species: mouse | Application: IF
  235. Assembly of lipid droplet-associated ring structures in hepatitis C virus-infected cells via liquid-liquid phase separation (LLPS) and non-LLPS mechanisms.
    Journal: J Virol | Authors: Mengyu Jiao
  236. Orf virus ORF120 protein positively regulates the NF-κB pathway by interacting with G3BP1.
    Journal: J Virol | Authors: Yanlong Zhou | Species: Human | Application: WB
  237. TLR and IKK Complex-Mediated Innate Immune Signaling Inhibits Stress Granule Assembly.
    Journal: J Immunol | Authors: Parimal Samir | Species: mouse | Application: WB,IF
  238. Neuroprotective effects of ellorarxine in neuronal models of degeneration
    Journal: Front Neurosci | Authors: Azita Kouchmeshky | Species: mouse | Application: IF
  239. MxB inhibits long interspersed element type 1 retrotransposition.
    Journal: PLoS Genet | Authors: Yu Huang | Species: human | Application: WB,IF
  240. SAMHD1 Inhibits LINE-1 Retrotransposition by Promoting Stress Granule Formation.
    Journal: PLoS Genet | Authors: Siqi Hu | Species: human | Application: IF
  241. Multi-modal investigation reveals pathogenic features of diverse DDX3X missense mutations
    Journal: PLoS Genet | Authors: Federica Mosti | Species: human | Application: IF
  242. The mRNA-capping enzyme localizes to stress granules in the cytoplasm and maintains cap homeostasis of target mRNAs
    Journal: J Cell Sci | Authors: Anakshi Gayen | Species: human | Application: WB
  243. Proteasome inhibition by VR23 enhances autophagic clearance of FUS(P525L)-mediated persistent stress granule in SH-SY5Y cells.
    Journal: Mol Brain | Authors: Seong Hyun Kim | Species: human | Application: IF
  244. CircCBP Inhibits Influenza A Virus Replication by Interfering the vRNP Activity and Enhancing Antiviral Immune Response
    Journal: J Med Virol | Authors: Xinli Yao | Species: human | Application: WB
  245. Inhibition of cGAS-STING pathway by stress granules after activation of M2 macrophages by human mesenchymal stem cells against drug induced liver injury
    Journal: Mol Immunol | Authors: Yao Wang | Species: mouse | Application: IF
  246. Stress granules are formed in renal proximal tubular cells during metabolic stress and ischemic injury for cell survival.
    Journal: Am J Physiol Renal Physiol | Authors: Shixuan Wang | Species: mouse | Application: WB
  247. Stress granules are formed in renal proximal tubular cells during metabolic stress and ischemic injury for cell survival.
    Journal: Am J Physiol Renal Physiol | Authors: Shixuan Wang | Species: mouse | Application: WB
  248. Stress granules formation in HEI-OC1 auditory cells and in H4 human neuroglioma cells secondary to cisplatin exposure
    Journal: Cell Stress | Authors: Hebatallah Abdelrasol | Species: mouse,human | Application: WB,IF
  249. Upregulated LINC01088 facilitates malignant phenotypes and immune escape of colorectal cancer by regulating microRNAs/G3BP1/PD-L1 axis.
    Journal: J Cancer Res Clin Oncol | Authors: Chenmeng Li | Species: human | Application: WB
  250. FUS protein nuclear loss in skin biopsy: A window into the pathology and diagnosis of fused in sarcoma-associated amyotrophic lateral sclerosis.
    Journal: J Neuropathol Exp Neurol | Authors: Didi Shan | Species: human | Application: IF
  251. Clinical and experimental studies of a novel P525R FUS mutation in amyotrophic lateral sclerosis.
    Journal: Neurol Genet | Authors: Lisha Kuang | Species: mouse | Application: IF
  252. Genetic Profiling of African American Patients With Prostatic Adenocarcinoma Metastatic to the Lymph Nodes: A Pilot Study
    Journal: Arch Pathol Lab Med | Authors: Samuel Bidot | Species: human | Application: IHC
  253. DDX17 promotes DENV-2 replication via interaction with viral dsRNA and G3BP1
    Journal: Int J Med Microbiol | Authors: Peijun Han | Species: human | Application: IF
  254. The potential mechanism maintaining transactive response DNA binding protein 43 kDa in the mouse stroke model
    Journal: Neurosci Res | Authors: Yuting Bian | Species: mouse | Application: IF
  255. Stress granule assembly in vivo is deficient in the CNS of mutant TDP-43 ALS mice
    Journal: Hum Mol Genet | Authors: Alicia Dubinski | Species: mouse | Application: IF
  256. G3BP1 contributes to tumor metastasis via upregulation of Slug expression in hepatocellular carcinoma.
    Journal: Am J Cancer Res | Authors: Ning Dou | Species: Human | Application: IHC
  257. Quantitative proteomics identifies proteins that resist translational repression and become dysregulated in ALS-FUS.
    Journal: Hum Mol Genet | Authors: Desiree M Baron | Species: mouse | Application: IF
  258. Targeting LARP1 to mitigate aging in lens epithelial cells: mechanistic insights into mitochondrial dysfunction
    Journal: Exp Eye Res | Authors: Hang Qi
  259. Nucleolar stress and impaired stress granule formation contribute to C9orf72 RAN translation-induced cytotoxicity.
    Journal: Hum Mol Genet | Authors: Zhouteng Tao | Species: human | Application: WB,IF
  260. Lysine acetylation regulates the RNA binding, subcellular localization and inclusion formation of FUS.
    Journal: Hum Mol Genet | Authors: Alexandra Arenas | Species: mouse | Application: IF
  261. Reduced stress granule formation and cell death in fibroblasts with the A382T mutation of TARDBP gene: evidence for loss of TDP-43 nuclear function.
    Journal: Hum Mol Genet | Authors: Sandro Orrù | Species: human | Application: WB
  262. Quantitative proteomics identifies proteins that resist translational repression and become dysregulated in ALS-FUS.
    Journal: Hum Mol Genet | Authors: Desiree M Baron | Species: mouse | Application: IF
  263. Folliculin, a tumor suppressor associated with Birt-Hogg-Dubé (BHD) syndrome, is a novel modifier of TDP-43 cytoplasmic translocation and aggregation.
    Journal: Hum Mol Genet | Authors: Qin Xia | Species: human | Application: IF
  264. Inhibition of eIF2α Phosphorylation by Peste des Petits Ruminant Virus Phosphoprotein Facilitates Viral Replication.
    Journal: Front Vet Sci | Authors: Niyokwishimira Alfred | Species: human | Application: WB
  265. The ZSWIM8 ubiquitin ligase regulates neurodevelopment by guarding the protein quality of intrinsically disordered Dab1
    Journal: Cereb Cortex | Authors: Guan Wang | Species: mouse | Application: WB,IF
  266. Identification and validation of a novel stress granules-related prognostic model in colorectal cancer
    Journal: Front Genet | Authors: Zhihao Liu | Species: human | Application: IF
  267. G3BP isoforms differentially affect stress granule assembly and gene expression during cellular stress
    Journal: Mol Biol Cell | Authors: José M Liboy-Lugo | Species: human | Application: IF
  268. The Acetylation of Lysine-376 of G3BP1 Regulates RNA Binding and Stress Granule Dynamics.
    Journal: Mol Cell Biol | Authors: Jozsef Gal | Species: human | Application: WB,IF
  269. Coaggregation of RNA-binding proteins in a model of TDP-43 proteinopathy with selective RGG motif methylation and a role for RRM1 ubiquitination.
    Journal: PLoS One | Authors: Dammer Eric B EB | Species: human | Application: WB,IF
  270. Casein Kinase 2 is linked to stress granule dynamics through phosphorylation of the stress granule nucleating protein G3BP1.
    Journal: Mol Cell Biol | Authors: Lucas C Reineke | Species: human | Application: IP
  271. Localizatome: a database for stress-dependent subcellular localization changes in proteins
    Journal: Database (Oxford) | Authors: Takahide Matsushima | Species: human | Application: IF
  272. Quantitative Proteomic Analysis of the Metastasis-Inhibitory Mechanism of miR-193a-3p in Non-Small Cell Lung Cancer.
    Journal: Cell Physiol Biochem | Authors: Wei Deng | Species: human | Application: WB
  273. Rosmarinic acid ameliorates autoimmune responses through suppression of intracellular nucleic acid-mediated type I interferon expression
    Journal: Biochem Biophys Res Commun | Authors: Xiao-Wei Li | Species: human | Application: IP
  274. G3BP1 activates the TGF-β/Smad signaling pathway to promote gastric cancer.
    Journal: Onco Targets Ther | Authors: Rui Xiong | Species: human | Application: IHC
  275. Stress granules affect the sensitivity of renal cancer cells to sorafenib by sequestering and stabilizing COX‑2 mRNA
    Journal: Oncol Lett | Authors: Huiqi Dai | Species: human | Application: WB,IF
  276. Galectin-3 binding protein links circulating microparticles with electron dense glomerular deposits in lupus nephritis.
    Journal: Lupus | Authors: C T Nielsen | Species: human | Application: IF
  277. A Quantitative Assay to Measure Stress Granule Association of Proteins and Peptidesin Semi-permeabilized Human Cells.
    Journal: Bio Protoc | Authors: Saskia Hutten | Species: human | Application: IHC
  278. Differential assembly of RNP granules via activation of distinct dsRNA sensors by adenovirus mutants.
    Journal: bioRxiv | Authors: Robert T. Steinbock | Species: human | Application: IF
  279. N/A
    Journal: N/A | Authors: N/A | Species: human | Application: IF
  280. Endogenous retrovirus-like proteins recruit UBQLN2 to stress granules and alter their functional properties
    Journal: bioRxiv | Authors: Harihar M Mohan | Species: human | Application: WB
  281. Induction of translation-suppressive G3BP1+ stress granules and interferon-signaling cGAS condensates by transfected plasmid DNA
    Journal: Hlife | Authors: Vladimir Majerciak | Species: human | Application: IF
  282. TDP-43 Aggregate Seeding Impairs Autoregulation and Causes TDP-43 Dysfunction
    Journal: bioRxiv | Authors: Lohany Dias Mamede | Species: human | Application: IF
  283. HP-Bodies - Ancestral Condensates that Regulate RNA Turnover and Protein Translation in Bacteria
    Journal: bioRxiv | Authors: Jian Guan | Species: mouse | Application: IF
  284. Rapid and inducible mislocalization of endogenous TDP43 in a novel human model of amyotrophic lateral sclerosis
    Journal: Elife | Authors: Johanna Ganssauge
  285. Interaction between host G3BP and viral nucleocapsid protein regulates SARS-CoV-2 replication
    Journal: bioRxiv | Authors: Zemin Yang | Species: human | Application: WB,IF
  286. Overexpression of RBM15 modulated the effect of trophoblast cells by promoting the binding ability between YTHDF2 and the CD82 3'UTR to decrease the expression of CD82
    Journal: Heliyon | Authors: Guangning You | Species: human | Application: WB
  287. Induction of translation-suppressive G3BP1+ stress granules and interferon-signaling cGAS condensates by transfected plasmid DNA
    Journal: Hlife | Authors: Vladimir Majerciak | Species: human | Application: IF
  288. N/A
    Journal: N/A | Authors: N/A | Species: human | Application: IF
  289. Rapid and inducible mislocalization of endogenous TDP43 in a novel human model of amyotrophic lateral sclerosis
    Journal: Elife | Authors: Johanna Ganssauge
  290. Overexpression of RBM15 modulated the effect of trophoblast cells by promoting the binding ability between YTHDF2 and the CD82 3'UTR to decrease the expression of CD82
    Journal: Heliyon | Authors: Guangning You | Species: human | Application: WB
  291. Mitochondria-derived dsRNA-induced stress granules promote IRF3-mediated fibrotic responses
    Journal: bioRxiv | Authors: Jared Travers | Species: human | Application: WB,IF
  292. MARK4 enhances stress granule formation under oxidative stress and increases tau accumulation.
    Journal: FEBS Open Bio | Authors: Sho Nakajima
  293. Loss of O-GlcNAc transferase activity impairs the dynamic formation of protective stress granules in ischemic cardiomyocytes.
    Journal: Biochem J | Authors: Hannah C. Swimm
  294. The p97 adaptor p47/NSFL1C is necessary for stress granule dissolution after heat stress.
    Journal: Open Biol | Authors: Michelle A. Johnson | Species: human | Application: WB,IF
  295. MARK4 enhances stress granule formation under oxidative stress and increases tau accumulation.
    Journal: FEBS Open Bio | Authors: Sho Nakajima
  296. Loss of O-GlcNAc transferase activity impairs the dynamic formation of protective stress granules in ischemic cardiomyocytes.
    Journal: Biochem J | Authors: Hannah C. Swimm
  297. Identification of a novel linear B-cell epitope located on the regulator of virion expression protein of equine infectious anemia virus.
    Journal: Int J Biol Macromol | Authors: Huiling Ren

Reviews

Write Your Own Review
You're reviewing:G3BP1 Polyclonal antibody 13057-2-AP proteintech
Your Rating
Related Products
Check items to add to the cart or
  1. FcZero-rAb® APC Anti-Human CD4 (OKT4) Rabbit Recombinant Antibody APC-FcA65603 proteintech
    FcZero-rAb® APC Anti-Human CD4 (OKT4) Rabbit Recombinant Antibody APC-FcA65603 proteintech
    $59.00
    Add to Wish List Add to Compare
Copyright © 2025 Biogege, Inc. All rights reserved.