USP4 Monoclonal antibody 66822-1-Ig proteintech
$149.00
In stock
SKU
66822-1-Ig
| Catalog Number | 66822-1-Ig |
| Synonyms | 1G11G8, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP |
| Host | Mouse |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, FC (Intra), IP, ELISA |
| Applications | WB, IHC, IF-P, FC (Intra), ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | HeLa cells, Jurkat cells, HEK-293 cells, THP-1 cells, NCI-H1299 cells, RAW 264.7 cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human breast cancer tissue, human liver cancer tissue |
| Tested Applications — Positive FC (Intra) detected in | THP-1 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:100-1:300 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, Jurkat cells, HEK-293 cells, THP-1 cells, NCI-H1299 cells, RAW 264.7 cells |
| Positive IHC detected in | human breast cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue, human liver cancer tissue |
| Positive FC (Intra) detected in | THP-1 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:300 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag28297 Product name: Recombinant human USP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 567-779 aa of BC125131 Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR Predict reactive species |
| Full Name | ubiquitin specific peptidase 4 (proto-oncogene) |
| Calculated Molecular Weight | 963 aa, 109 kDa |
| Observed Molecular Weight | 109 kDa |
| GenBank Accession Number | BC125131 |
| Gene Symbol | USP4 |
| Gene ID (NCBI) | 7375 |
| RRID | AB_2882165 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13107 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for USP4 antibody 66822-1-Ig | Download protocol |
| IF protocol for USP4 antibody 66822-1-Ig | Download protocol |
| IHC protocol for USP4 antibody 66822-1-Ig | Download protocol |
| WB protocol for USP4 antibody 66822-1-Ig | Download protocol |
| human | WB,IHC NPJ Breast Cancer The deubiquitinating enzyme USP4 regulates BRCA1 stability and function Authors - Xueyuan Guo View Article |
| mouse | WB bioRxiv The DNA helicase FANCJ (BRIP1) functions in Double Strand Break repair processing, but not crossover formation during Prophase I of meiosis in male mice Authors - Tegan S Horan View Article |
| Citations | 14 |
| Dilutions | WB : 1:1000-1:6000 IHC : 1:100-1:300 IF-P : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 1G11G8 |
| Conjugation | Unconjugated |
USP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341). Protocols Product Specific Protocols FC protocol for USP4 antibody 66822-1-Ig Download protocol IF protocol for USP4 antibody 66822-1-Ig Download protocol IHC protocol for USP4 antibody 66822-1-Ig Download protocol WB protocol for USP4 antibody 66822-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- USP4 promotes the proliferation, migration, and invasion of esophageal squamous cell carcinoma by targeting TAK1
Journal: Cell Death Dis | Authors: Hongdian Zhang | Species: human | Application: IHC - Vialinin A alleviates oxidative stress and neuronal injuries after ischaemic stroke by accelerating Keap1 degradation through inhibiting USP4-mediated deubiquitination
Journal: Phytomedicine | Authors: Meng Mao | Species: human | Application: WB - The DNA helicase FANCJ (BRIP1) functions in Double Strand Break repair processing, but not crossover formation during Prophase I of meiosis in male mice
Journal: bioRxiv | Authors: Tegan S Horan | Species: mouse | Application: WB - The deubiquitinating enzyme USP4 regulates BRCA1 stability and function
Journal: NPJ Breast Cancer | Authors: Xueyuan Guo | Species: human | Application: WB,IHC - The TNRC6B/circTNRC6B axis drives lymphovascular invasion and metastasis through an intragenic self-degradation loop.
Journal: Cell Rep | Authors: Lingjiao Meng - USP4-mediated CENPF deubiquitylation regulated tumor metastasis in colorectal cancer
Journal: Cell Death Dis | Authors: Zhongdong Xie - The deubiquitinating enzyme USP4 regulates BRCA1 stability and function
Journal: NPJ Breast Cancer | Authors: Xueyuan Guo | Species: human | Application: WB,IHC - Melatonin-engineered MSCs-exosomes deliver USP4 to stabilise ARNTL and inhibit clock rhythmic ferroptosis for enhanced flap survival.
Journal: Clin Transl Med | Authors: Xiaoqiong Jiang | Species: human,mouse | Application: IF - The TNRC6B/circTNRC6B axis drives lymphovascular invasion and metastasis through an intragenic self-degradation loop.
Journal: Cell Rep | Authors: Lingjiao Meng - Oncogenic KRAS effector USP13 promotes metastasis in non-small cell lung cancer through deubiquitinating β-catenin
Journal: Cell Rep | Authors: Yanguan Guo | Species: human | Application: WB - IL27RA promotes the proliferation and metastasis of hepatocellular carcinoma cells by regulating TGFβR1.
Journal: Sci Rep | Authors: YiJie Zhang | Species: human | Application: WB - The DNA helicase FANCJ (BRIP1) functions in double strand break repair processing, but not crossover formation during prophase I of meiosis in male mice
Journal: PLoS Genet | Authors: Tegan S Horan | Species: mouse | Application: WB - USP4 promotes the proliferation and glucose metabolism of gastric cancer cells by upregulating PKM2
Journal: PLoS One | Authors: Yuanyuan Chen | Species: human | Application: WB,IP,IF - The DNA helicase FANCJ (BRIP1) functions in Double Strand Break repair processing, but not crossover formation during Prophase I of meiosis in male mice
Journal: bioRxiv | Authors: Tegan S Horan | Species: mouse | Application: WB
Reviews
Write Your Own Review