CSRP1 Polyclonal antibody 13432-1-AP proteintech
$149.00
In stock
SKU
13432-1-AP
| Catalog Number | 13432-1-AP |
| Synonyms | CRP, CRP1, CSRP, CYRP, Cysteine and glycine-rich protein 1 |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human stomach tissue, HeLa cells |
| Tested Applications — Positive IP detected in | mouse stomach tissue |
| Tested Applications — Positive IHC detected in | human normal colon, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | human stomach tissue, HeLa cells |
| Positive IP detected in | mouse stomach tissue |
| Positive IHC detected in | human normal colon, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4236 Product name: Recombinant human CSRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC032493 Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE Predict reactive species |
| Full Name | cysteine and glycine-rich protein 1 |
| Calculated Molecular Weight | 193 aa, 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC032493 |
| Gene Symbol | CSRP1 |
| Gene ID (NCBI) | 1465 |
| RRID | AB_2230180 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21291 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CSRP1 antibody 13432-1-AP | Download protocol |
| IP protocol for CSRP1 antibody 13432-1-AP | Download protocol |
| WB protocol for CSRP1 antibody 13432-1-AP | Download protocol |
| mouse | WB,IF Mol Psychiatry PD-L1/PD-1 checkpoint pathway regulates astrocyte morphogenesis and myelination during brain development Authors - Yanyan Wang View Article |
| rat | WB Mol Med Rep Inflammatory and oxidative stress‑associated factors in chronic intermittent hypoxia in Chinese patients, rats, lymphocytes and endotheliocytes. Authors - Hui Ren View Article |
| human | WB FASEB J The Involvement of CSRP1 in Neuroblastoma Differentiation and Apoptosis Impacting Tumor-Suppressive Therapeutic Responses Authors - Yu-Han Lin View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CSRP1 (Cysteine and glycine-rich protein 1), designated initially as CRP1, constitutes a cysteine-rich protein derived from placental sources and exhibits a response profile analogous to c-myc. CSRP1 has been recognized as a tumor suppressor in several types of cancers including colorectal cancer, and cholangiocarcinoma (PMID: 37113556). Abnormal expression of CSRP1 was reported within several malignancies such as prostate cancer and acute myeloid leukemia (PMID: 38813484, 40198006). Protocols Product Specific Protocols IHC protocol for CSRP1 antibody 13432-1-AP Download protocol IP protocol for CSRP1 antibody 13432-1-AP Download protocol WB protocol for CSRP1 antibody 13432-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- PD-L1/PD-1 checkpoint pathway regulates astrocyte morphogenesis and myelination during brain development
Journal: Mol Psychiatry | Authors: Yanyan Wang | Species: mouse | Application: WB,IF - Inflammatory and oxidative stress‑associated factors in chronic intermittent hypoxia in Chinese patients, rats, lymphocytes and endotheliocytes.
Journal: Mol Med Rep | Authors: Hui Ren | Species: rat | Application: WB - The Involvement of CSRP1 in Neuroblastoma Differentiation and Apoptosis Impacting Tumor-Suppressive Therapeutic Responses
Journal: FASEB J | Authors: Yu-Han Lin | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
