Cystatin A Recombinant monoclonal antibody, PBS Only (Detector) 84953-2-PBS proteintech
$699.00
In stock
SKU
84953-2-PBS
| Catalog Number | 84953-2-PBS |
| Synonyms | CSTA, Cystatin AS, Cystatin-A, Cystatin-A, N-terminally processed, Stefin-A |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag8733 Product name: Recombinant human CSTA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC010379 Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF Predict reactive species |
| Full Name | cystatin A (stefin A) |
| Calculated Molecular Weight | 98 aa, 11 kDa |
| GenBank Accession Number | BC010379 |
| Gene Symbol | Cystatin A |
| Gene ID (NCBI) | 1475 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P01040 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242558G3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
