TMEM106B (1-46aa) Monoclonal antibody 60333-1-Ig proteintech
$149.00
In stock
SKU
60333-1-Ig
| Catalog Number | 60333-1-Ig |
| Synonyms | TMEM106B, 5D1F8, Transmembrane protein 106B |
| Host | Mouse |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, CoIP, ELISA |
| Applications | WB, IP, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | U2OS cells, HeLa cells, K-562 cells, LNCaP cells, A549 cells, Jurkat cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | U2OS cells, HeLa cells, K-562 cells, LNCaP cells, A549 cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag21448 Product name: Recombinant human TMEM106B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC033901 Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS Predict reactive species |
| Full Name | transmembrane protein 106B |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | ~40 kDa |
| GenBank Accession Number | BC033901 |
| Gene Symbol | TMEM106B |
| Gene ID (NCBI) | 54664 |
| RRID | AB_2881442 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9NUM4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for TMEM106B (1-46aa) antibody 60333-1-Ig | Download protocol |
| WB protocol for TMEM106B (1-46aa) antibody 60333-1-Ig | Download protocol |
| human | WB,IHC,IF Acta Neuropathol Commun Divergent and convergent TMEM106B pathology in murine models of neurodegeneration and human disease. Authors - Muzi Du View Article |
| Citations | 12 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 5D1F8 |
| Conjugation | Unconjugated |
TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression. Protocols Product Specific Protocols IP protocol for TMEM106B (1-46aa) antibody 60333-1-Ig Download protocol WB protocol for TMEM106B (1-46aa) antibody 60333-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Homotypic fibrillization of TMEM106B across diverse neurodegenerative diseases.
Journal: Cell | Authors: Andrew Chang | Species: human - C-terminal TMEM106B fragments in human brain correlate with disease-associated TMEM106B haplotypes
Journal: Brain | Authors: Cristina T Vicente | Species: human | Application: WB - TESC acts as a prognostic factor and promotes epithelial-mesenchymal transition progression in esophageal squamous carcinoma
Journal: Pathol Res Pract | Authors: Yanxin Dong | Species: human | Application: WB - Estradiol facilitates urate excretion by reducing GLUT9 expression via ERβ/TMEM106B/PI3K/AKT1 pathway in renal tubular epithelial cells.
Journal: Int J Biochem Cell Biol | Authors: Haijun Liu | Species: human | Application: CoIP - Lysosomal membrane protein TMEM106B modulates hematopoietic stem and progenitor cell proliferation and differentiation by regulating LAMP2A stability
Journal: FASEB J | Authors: Di Guo | Species: human | Application: WB - Divergent and convergent TMEM106B pathology in murine models of neurodegeneration and human disease.
Journal: Acta Neuropathol Commun | Authors: Muzi Du | Species: human | Application: WB,IHC,IF
Reviews
Write Your Own Review