CDC25C Monoclonal antibody 66912-1-Ig proteintech
$149.00
In stock
SKU
66912-1-Ig
| Catalog Number | 66912-1-Ig |
| Synonyms | 2B6B12, CDC25, EC:3.1.3.48, M phase inducer phosphatase 3, M-phase inducer phosphatase 3 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Raji cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Raji cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag10240 Product name: Recombinant human CDC25C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-279 aa of BC019089 Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQ Predict reactive species |
| Full Name | cell division cycle 25 homolog C (S. pombe) |
| Calculated Molecular Weight | 473 aa, 53 kDa |
| Observed Molecular Weight | 46-53 kDa |
| GenBank Accession Number | BC019089 |
| Gene Symbol | CDC25C |
| Gene ID (NCBI) | 995 |
| RRID | AB_2882239 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P30307 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for CDC25C antibody 66912-1-Ig | Download protocol |
| mouse | WB Toxicology ATM deficiency aggravates the progression of liver fibrosis induced by carbon tetrachloride in mice Authors - Ming Li View Article |
| mouse,human | WB iScience Bombinin-BO1 induces hepatocellular carcinoma cell-cycle arrest and apoptosis via the HSP90A-Cdc37-CDK1 axis Authors - Xiaoting Wang View Article |
| human | WB Food Chem Toxicol DON entry into the nucleus induces DNA damage, apoptosis and cycle arrest in GES-1 cells Authors - Silu Hou View Article |
| Angélique (Verified Customer) (11-25-2021) | on 20ug total proteins Applications: Western Blot Primary Antibody Dilution: 1/2000 Cell Tissue Type: murine hepatocytes CDC25C Antibody Western Blot validation (1/2000 dilution) in murine hepatocytes (Cat no:66912-1-Ig) |
| Citations | 11 |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2B6B12 |
| Conjugation | Unconjugated |
The cell division cycle 25 (CDC25) family of proteins are highly conserved dual specificity phosphatases that activate cyclin-dependent kinase (CDK) complexes, which in turn regulate progression through the cell division cycle. CDC25C (cell division cycle 25 homolog C) is one of the 3 isoforms of CDC25 in mammalian cells. It is present in the cytoplasm of asynchronously growing human cells (PMID:10330186). And it may be phosphorylated by its own substrate, an active cdc2-cyclin B complex, to create an autoactivation loop (PMID:7937793). It can be hyperphosphorylated to get the active form of 70 kDa (PMID:18296513). CDC25C has some isofroms with molecular mass of 46-53 kDa. Protocols Product Specific Protocols WB protocol for CDC25C antibody 66912-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- High-dose zearalenone exposure disturbs G2/M transition during mouse oocyte maturation.
Journal: Reprod Toxicol | Authors: Yi-Ming Ji | Species: mouse | Application: WB - Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis.
Journal: Oncol Lett | Authors: Jun Ma | Species: mouse | Application: WB - Bombinin-BO1 induces hepatocellular carcinoma cell-cycle arrest and apoptosis via the HSP90A-Cdc37-CDK1 axis
Journal: iScience | Authors: Xiaoting Wang | Species: mouse,human | Application: WB - ATM deficiency aggravates the progression of liver fibrosis induced by carbon tetrachloride in mice
Journal: Toxicology | Authors: Ming Li | Species: mouse | Application: WB - Eupalinolide A inhibits cancer progression and induces ferroptosis and apoptosis by targeting the AMPK/mTOR/SCD1 signalling in non-small cell lung cancer.
Journal: Front Pharmacol | Authors: Yonghui Zhang | Species: human | Application: WB - DON entry into the nucleus induces DNA damage, apoptosis and cycle arrest in GES-1 cells
Journal: Food Chem Toxicol | Authors: Silu Hou | Species: human | Application: WB - Aluminum exposure impairs nuclear envelope breakdown for mouse zygote formation.
Journal: iScience | Authors: Xiao-Ting Yu | Species: mouse | Application: WB - Bombinin-BO1 induces hepatocellular carcinoma cell-cycle arrest and apoptosis via the HSP90A-Cdc37-CDK1 axis
Journal: iScience | Authors: Xiaoting Wang | Species: mouse,human | Application: WB - High-dose zearalenone exposure disturbs G2/M transition during mouse oocyte maturation.
Journal: Reprod Toxicol | Authors: Yi-Ming Ji | Species: mouse | Application: WB - DON entry into the nucleus induces DNA damage, apoptosis and cycle arrest in GES-1 cells
Journal: Food Chem Toxicol | Authors: Silu Hou | Species: human | Application: WB - Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis.
Journal: Oncol Lett | Authors: Jun Ma | Species: mouse | Application: WB
Product Documents
Reviews
Write Your Own Review