CoraLite®594 Anti-Mouse CXCL1 Rabbit Recombinant Antibody CL594-98047 proteintech
$270.00
In stock
SKU
CL594-98047
| Catalog Number | CL594-98047 |
| Synonyms | 240268D2, chemokine (C X C motif) ligand 1, Growth-regulated alpha protein |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS, Azide |
| Applications | FC (Intra) |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC (Intra) detected in | LPS and Brefeldin A treated mouse splenocytes |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension |
| Positive FC (Intra) detected in | LPS and Brefeldin A treated mouse splenocytes |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0303 Product name: Recombinant Mouse CXCL1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 25-96 aa of NM_008176 Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 1 |
| Calculated Molecular Weight | 10kd |
| GenBank Accession Number | NM_008176 |
| Gene Symbol | Cxcl1 |
| Gene ID (NCBI) | 14825 |
| RRID | AB_3673561 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P12850-1 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for CL594 CXCL1 antibody CL594-98047 | Download protocol |
| Citations | - |
| Dilutions | FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240268D2 |
| Conjugation | CoraLite®594 |
CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers. Protocols Product Specific Protocols FC protocol for CL594 CXCL1 antibody CL594-98047 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
