CoraLite® Plus 647 Anti-Mouse CXCL2 Rabbit Recombinant Antibody CL647-98259 proteintech

$439.00
In stock
SKU
CL647-98259
Catalog No.SizePrice (USD)
CL647-98259-100UG100 μg$439.00
Catalog NumberCL647-98259
Synonyms242007G5, C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2, Mip-2
HostRabbit
Reactivitymouse
FormLiquid
FormulationPBS, Azide
ApplicationsFC (Intra)
Host / IsotypeRabbit / IgG
Tested Applications — Positive FC (Intra) detected inLPS and Brefeldin A treated RAW 264.7 cells
Recommended Dilutions — Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Positive FC (Intra) detected inLPS and Brefeldin A treated RAW 264.7 cells
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Tested Reactivitymouse
ClassRecombinant
TypeAntibody
ImmunogenCatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species
Full Namechemokine (C-X-C motif) ligand 2
Calculated Molecular Weight11 kDa
GenBank Accession NumberNM_009140
Gene SymbolCxcl2
Gene ID (NCBI)20310
RRIDAB_3748835
ConjugateCoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
Purification MethodProtein A purification
UNIPROT IDP10889
Storage BufferPBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.
FC protocol for CL Plus 647 CXCL2 antibody CL647-98259Download protocol
Citations-
DilutionsFC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
IsotypeIgG
ClonalityRecombinant
Clone Number242007G5
ConjugationCoraLite® Plus 647

CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays a critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246). Protocols Product Specific Protocols FC protocol for CL Plus 647 CXCL2 antibody CL647-98259 Download protocol Standard Protocols Click here to view our Standard Protocols

Product Documents

Datasheet

Reviews

Write Your Own Review
You're reviewing:CoraLite® Plus 647 Anti-Mouse CXCL2 Rabbit Recombinant Antibody CL647-98259 proteintech
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.