CoraLite® Plus 647 Anti-Mouse CXCL2 Rabbit Recombinant Antibody CL647-98259 proteintech
$439.00
In stock
SKU
CL647-98259
| Catalog Number | CL647-98259 |
| Synonyms | 242007G5, C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2, Mip-2 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS, Azide |
| Applications | FC (Intra) |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC (Intra) detected in | LPS and Brefeldin A treated RAW 264.7 cells |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive FC (Intra) detected in | LPS and Brefeldin A treated RAW 264.7 cells |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 2 |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_009140 |
| Gene Symbol | Cxcl2 |
| Gene ID (NCBI) | 20310 |
| RRID | AB_3748835 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P10889 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for CL Plus 647 CXCL2 antibody CL647-98259 | Download protocol |
| Citations | - |
| Dilutions | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242007G5 |
| Conjugation | CoraLite® Plus 647 |
CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays a critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246). Protocols Product Specific Protocols FC protocol for CL Plus 647 CXCL2 antibody CL647-98259 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents