CXCL4/PF4 Recombinant monoclonal antibody, PBS Only 85647-1-PBS proteintech
$699.00
In stock
SKU
85647-1-PBS
| Catalog Number | 85647-1-PBS |
| Synonyms | CXCL4, PF4, SCYB4, C X C motif chemokine 4, C-X-C motif chemokine 4 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2129 Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-101 aa of NM_002619.4 Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species |
| Full Name | platelet factor 4 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_002619.4 |
| Gene Symbol | PF4 |
| Gene ID (NCBI) | 5196 |
| RRID | AB_3744264 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P02776 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 243087F2 |
| Conjugation | Unconjugated |
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
