LIX/CXCL5 Polyclonal antibody, PBS Only 10809-1-PBS proteintech
$699.00
In stock
SKU
10809-1-PBS
| Catalog Number | 10809-1-PBS |
| Synonyms | CXCL5, C X C motif chemokine 5, C-X-C motif chemokine 5, CXCL 5, CXCL-5 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1079 Product name: Recombinant human CXCL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC008376 Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 5 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC008376 |
| Gene Symbol | CXCL5 |
| Gene ID (NCBI) | 6374 |
| RRID | AB_2292366 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42830 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
