CXCL7/PPBP Recombinant monoclonal antibody 86907-3-RR proteintech
$149.00
In stock
SKU
86907-3-RR
| Catalog Number | 86907-3-RR |
| Synonyms | Chemokine subfamily B Cys-X-Cys Platelet basic protein Thymus chemokine 1, Cxcl7, Ppbp |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse spleen tissue, mouse serum |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | mouse spleen tissue, mouse serum |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2806 Product name: Recombinant Mouse CXCL7/PPBP protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 48-109 aa of NM_023785.3 Sequence: IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI Predict reactive species |
| Full Name | pro-platelet basic protein |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_023785.3 |
| Gene Symbol | Ppbp |
| Gene ID (NCBI) | 57349 |
| RRID | AB_3745199 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9EQI5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for CXCL7/PPBP antibody 86907-3-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251068A3 |
| Conjugation | Unconjugated |
PPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. Protocols Product Specific Protocols WB protocol for CXCL7/PPBP antibody 86907-3-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
