CXCR3 Recombinant monoclonal antibody, PBS Only 84655-5-PBS proteintech
$699.00
In stock
SKU
84655-5-PBS
| Catalog Number | 84655-5-PBS |
| Synonyms | 241790E9, CD182, CD183, CKR L2, CKR-L2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2269 Product name: Recombinant Human CXCR3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-53 aa of BC034403 Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 3 |
| Calculated Molecular Weight | 368 aa, 41 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC034403 |
| Gene Symbol | CXCR3 |
| Gene ID (NCBI) | 2833 |
| RRID | AB_3743632 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P49682 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241790E9 |
| Conjugation | Unconjugated |
CXCR3 (C-X-C chemokine receptor type 3) is a G protein-coupled, seven-transmembrane domain chemokine receptor that is expressed on the surface of several cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells (PMID: 16847335). CXCR3 binds and is activated by the three IFN-gamma-inducible chemokines: CXCL9, CXCL10, and CXCL11. The binding of these ligands to CXCR3 has been implicated in regulating T-cell infiltration during inflammation and tissue injury (PMID: 17250586). Alternatively, spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms, CXCR3B, mediates the angiostatic activity of CXCR3 ligands and also acts as a functional receptor for CXCL4 (PMID:12782716).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
