PADI2 Monoclonal antibody 66386-1-Ig proteintech
$149.00
In stock
SKU
66386-1-Ig
| Catalog Number | 66386-1-Ig |
| Synonyms | EC:3.5.3.15, KIAA0994, PAD H19, PAD2, PAD-H19 |
| Host | Mouse |
| Reactivity | human, mouse, rat, pig, rabbit |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | human skeletal muscle tissue, HeLa cells, MCF-7 cells, pig brain tissue, rat brain tissue, mouse brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue |
| Tested Applications — Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human breast cancer tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | human skeletal muscle tissue, HeLa cells, MCF-7 cells, pig brain tissue, rat brain tissue, mouse brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17612 Product name: Recombinant human PADI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 118-438 aa of BC009701 Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL Predict reactive species |
| Full Name | peptidyl arginine deiminase, type II |
| Calculated Molecular Weight | 665 aa, 75 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | BC009701 |
| Gene Symbol | PADI2 |
| Gene ID (NCBI) | 11240 |
| RRID | AB_2881762 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Y2J8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PADI2 antibody 66386-1-Ig | Download protocol |
| IHC protocol for PADI2 antibody 66386-1-Ig | Download protocol |
| WB protocol for PADI2 antibody 66386-1-Ig | Download protocol |
| mouse | WB,IHC Cell Death Dis Peptidylarginine deiminase 2 plays a key role in osteogenesis by enhancing RUNX2 stability through citrullination Authors - Hyun-Jung Kim KD Validated View Article |
| human | WB Life Sci Salvianolic acid A inhibits tumor cell proliferation and induces chromosomal abnormalities by blocking the citrullinating enzyme PADs. Authors - Jun Chen KD Validated View Article |
| mouse,human | WB,IF Cell Mol Life Sci ROS-induced PADI2 downregulation accelerates cellular senescence via the stimulation of SASP production and NFκB activation. Authors - Hyun-Jung Kim KD Validated View Article |
| Citations | 11 |
| Dilutions | WB : 1:1000-1:6000 IHC : 1:100-1:400 IF-P : 1:50-1:500 |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 2D8C12 |
| Conjugation | Unconjugated |
PADI2, also named as KIAA0994, PDI2, PAD-H19 and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa. Protocols Product Specific Protocols IF protocol for PADI2 antibody 66386-1-Ig Download protocol IHC protocol for PADI2 antibody 66386-1-Ig Download protocol WB protocol for PADI2 antibody 66386-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Cholinergic dysfunction-induced insufficient activation of alpha7 nicotinic acetylcholine receptor drives the development of rheumatoid arthritis through promoting protein citrullination via the SP3/PAD4 pathway
Journal: Acta Pharm Sin B | Authors: Changjun Lv | Species: mouse | Application: IF - Peptidylarginine deiminase 2 plays a key role in osteogenesis by enhancing RUNX2 stability through citrullination
Journal: Cell Death Dis | Authors: Hyun-Jung Kim KD Validated | Species: mouse | Application: WB,IHC - Protein citrullination as a source of cancer neoantigens.
Journal: J Immunother Cancer | Authors: Hiroyuki Katayama | Species: human | Application: IHC - Fuhu Lijie Tang treats rheumatoid arthritis through multitarget therapy from autoantigen formation to bone destruction
Journal: Phytomedicine | Authors: Zhongliu Yao - ROS-induced PADI2 downregulation accelerates cellular senescence via the stimulation of SASP production and NFκB activation.
Journal: Cell Mol Life Sci | Authors: Hyun-Jung Kim KD Validated | Species: mouse,human | Application: WB,IF - Salvianolic acid A inhibits tumor cell proliferation and induces chromosomal abnormalities by blocking the citrullinating enzyme PADs.
Journal: Life Sci | Authors: Jun Chen KD Validated | Species: human | Application: WB - Changes in the Oligodendrocyte Progenitor Cell Proteome with Ageing.
Journal: Mol Cell Proteomics | Authors: Alerie G de la Fuente | Species: rat | Application: WB - Small molecule activates citrullination through targeting PAD2
Journal: Philos Trans R Soc Lond B Biol Sci | Authors: Xue Zhang | Species: human | Application: WB - Citrullinated ENO1 Vaccine Enhances PD-1 Blockade in Mice Implanted with Murine Triple-Negative Breast Cancer Cells
Journal: Vaccines (Basel) | Authors: Ricardo A León-Letelier | Species: human | Application: IHC - Quantitative evaluation of citrullinated fibrinogen for detection of neutrophil extracellular traps
Journal: Immunol Res | Authors: Tsubasa Sue | Species: human | Application: WB - Independent Roles of Host and Bacterial PAD Enzymes in Periodontitis.
Journal: J Dent Res | Authors: X. Su
Reviews
Write Your Own Review