CYP2C9 Polyclonal antibody 16355-1-AP proteintech
$149.00
In stock
SKU
16355-1-AP
| Catalog Number | 16355-1-AP |
| Synonyms | (R) limonene 6 monooxygenase, (S) limonene 6 monooxygenase, (S) limonene 7 monooxygenase, CPC9, CYP2C, CYP2C10, CYP2C9, CYPIIC9, Cytochrome P 450MP, Cytochrome P450 2C9, Cytochrome P450 MP 4, Cytochrome P450 MP 8, Cytochrome P450 PB 1, P450IIC9, S mephenytoin 4 hydroxylase |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, SMMC-7721 cells, rat liver tissue |
| Tested Applications — Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Positive WB detected in | mouse liver tissue, SMMC-7721 cells, rat liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9566 Product name: Recombinant human CYP2C9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-162 aa of BC020754 Sequence: MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG Predict reactive species |
| Full Name | cytochrome P450, family 2, subfamily C, polypeptide 9 |
| Calculated Molecular Weight | 162aa,18 kDa; 490aa,56 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC020754 |
| Gene Symbol | CYP2C9 |
| Gene ID (NCBI) | 1559 |
| RRID | AB_3085487 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11712 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CYP2C9 antibody 16355-1-AP | Download protocol |
| WB protocol for CYP2C9 antibody 16355-1-AP | Download protocol |
| human | WB Naunyn Schmiedebergs Arch Pharmacol Paeoniflorin's role in inhibiting malignant metastasis of gastrointestinal stromal tumors via CYP3A4 modulation. Authors - Dapeng Cui View Article |
| mouse | WB Nat Commun Pla2g7 regulates bone homeostasis via Alox12/12-HETE/Gpr31 signaling axis. Authors - Jiayan Jin View Article |
| rat | WB BMC Complement Med Ther Herb-drug interaction of Astragali Radix based on in vitro incubation and pharmacokinetic assessment. Authors - Tianwang Wang View Article |
| Citations | 5 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CYP2C9 (Cytochrome P450 Family 2 Subfamily C Member 9) is a crucial cytochrome P450 enzyme, which plays a significant role in the metabolism, by oxidation, of both xenobiotic and endogenous compounds. CYP2C9 is primarily expressed in the liver, and the expression level is reported to be the second highest among CYP isoforms(PMID: 20150829). Protocols Product Specific Protocols IHC protocol for CYP2C9 antibody 16355-1-AP Download protocol WB protocol for CYP2C9 antibody 16355-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The role of glucocorticoids in hepatocellular carcinoma through integrated bioinformatics analysis and experimental validation
Journal: Sci Rep | Authors: Ao Wang | Species: human | Application: IHC - Bioinformatics identification of key microRNA-correlated genes associated with hepatocellular carcinoma heterogeneity and prognosis.
Journal: BMC Gastroenterol | Authors: Guomiao Su | Species: human | Application: WB - Pla2g7 regulates bone homeostasis via Alox12/12-HETE/Gpr31 signaling axis.
Journal: Nat Commun | Authors: Jiayan Jin | Species: mouse | Application: WB - Herb-drug interaction of Astragali Radix based on in vitro incubation and pharmacokinetic assessment.
Journal: BMC Complement Med Ther | Authors: Tianwang Wang | Species: rat | Application: WB - Paeoniflorin's role in inhibiting malignant metastasis of gastrointestinal stromal tumors via CYP3A4 modulation.
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Dapeng Cui | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
