CD61 / Integrin beta 3 Monoclonal antibody 66952-1-Ig proteintech
$149.00
In stock
SKU
66952-1-Ig
| Catalog Number | 66952-1-Ig |
| Synonyms | CD61, GP3A, GPIIIa, Integrin beta 3, ITGB3 |
| Host | Mouse |
| Reactivity | Human and More (2) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | HUVEC cells, human placenta tissue |
| Tested Applications — Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Positive WB detected in | HUVEC cells, human placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27834 Product name: Recombinant human ITGB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 634-718 aa of BC127666 Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD Predict reactive species |
| Full Name | integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) |
| Calculated Molecular Weight | 788 aa, 87 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC127666 |
| Gene Symbol | Integrin beta 3 |
| Gene ID (NCBI) | 3690 |
| RRID | AB_2882275 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P05106 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CD61 / Integrin beta 3 antibody 66952-1-Ig | Download protocol |
| WB protocol for CD61 / Integrin beta 3 antibody 66952-1-Ig | Download protocol |
| human,mouse | WB,IHC Sci Rep Periostin secreted by activated fibroblasts in idiopathic pulmonary fibrosis promotes tumorigenesis of non-small cell lung cancer. Authors - Hiroyuki Yamato KD Validated View Article |
| human | IHC Front Neurosci Histological analysis of thrombus composition in acute ischemic stroke with large vessel occlusion: impact of r-tPA treatment. Authors - Changzhi Zhao View Article |
| mouse | WB Drug Deliv Suppression for lung metastasis by depletion of collagen I and lysyl oxidase via losartan assisted with paclitaxel-loaded pH-sensitive liposomes in breast cancer Authors - Li Zhang View Article |
| Citations | 8 |
| Dilutions | WB : 1:1000-1:6000 IHC : 1:1000-1:4000 |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 3D8E5 |
| Conjugation | Unconjugated |
Integrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa. Protocols Product Specific Protocols IHC protocol for CD61 / Integrin beta 3 antibody 66952-1-Ig Download protocol WB protocol for CD61 / Integrin beta 3 antibody 66952-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Periostin secreted by activated fibroblasts in idiopathic pulmonary fibrosis promotes tumorigenesis of non-small cell lung cancer.
Journal: Sci Rep | Authors: Hiroyuki Yamato KD Validated | Species: human,mouse | Application: WB,IHC - Expression of Talin-1 in endometriosis and its possible role in pathogenesis.
Journal: Reprod Biol Endocrinol | Authors: Xian Tang | Species: human | Application: WB - αvβ3-targeted sEVs for efficient intracellular delivery of proteins using MFG-E8.
Journal: BMC Biotechnol | Authors: Junxin Mai | Species: human | Application: WB,IP - Nanobody-Conjugated Theranostic Prodrug Targeting α(v)β(3) Integrin Enables Precision Cancer Therapy With Real-Time Imaging.
Journal: Adv Healthc Mater | Authors: Sanu Karan | Species: human | Application: WB - Suppression for lung metastasis by depletion of collagen I and lysyl oxidase via losartan assisted with paclitaxel-loaded pH-sensitive liposomes in breast cancer
Journal: Drug Deliv | Authors: Li Zhang | Species: mouse | Application: WB - Histological analysis of thrombus composition in acute ischemic stroke with large vessel occlusion: impact of r-tPA treatment.
Journal: Front Neurosci | Authors: Changzhi Zhao | Species: human | Application: IHC - ITCH-Mediated Ubiquitylation of ITGB3 Promotes Cell Proliferation and Invasion of Ectopic Endometrial Stromal Cells in Ovarian Endometriosis
Journal: Biomedicines | Authors: Liansuo Zhang | Species: human | Application: WB,IP - Histological analysis of thrombus composition in acute ischemic stroke with large vessel occlusion: impact of r-tPA treatment.
Journal: Front Neurosci | Authors: Changzhi Zhao | Species: human | Application: IHC
Reviews
Write Your Own Review