Calponin 1 Monoclonal antibody, PBS Only (Detector) 66540-1-PBS proteintech
$699.00
In stock
SKU
66540-1-PBS
| Catalog Number | 66540-1-PBS |
| Synonyms | Calponin, CNN1, 1A11E5, Basic calponin, Calponin-1 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species |
| Full Name | calponin 1, basic, smooth muscle |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 33-35 kDa |
| GenBank Accession Number | BC022015 |
| Gene Symbol | Calponin |
| Gene ID (NCBI) | 1264 |
| RRID | AB_2881902 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P51911 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 1A11E5 |
| Conjugation | Unconjugated |
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
