Rat MCP-1/CCL2 Recombinant monoclonal antibody, PBS Only (Detector) 83370-2-PBS proteintech
$699.00
In stock
SKU
83370-2-PBS
| Catalog Number | 83370-2-PBS |
| Synonyms | Ccl2, 240341G3, C-C motif chemokine 2, CCL 2, CCL-2 |
| Host | Rabbit |
| Reactivity | rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0397 Product name: Recombinant Rat Ccl2 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-148 aa of NM_031530 Sequence: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 2 |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | NM_031530 |
| Gene Symbol | MCP-1/CCL2 |
| Gene ID (NCBI) | 24770 |
| RRID | AB_3671024 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P14844 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240341G3 |
| Conjugation | Unconjugated |
Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation.