Mouse Cd302 Recombinant monoclonal antibody, PBS Only (Capture) 85813-6-PBS proteintech
$699.00
In stock
SKU
85813-6-PBS
| Catalog Number | 85813-6-PBS |
| Synonyms | CD302 antigen, Clec13a, C-type lectin domain family 13 member A, Type I transmembrane C-type lectin receptor DCL-1 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2660 Product name: Recombinant Mouse CD302 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-156 aa of NM_025422.4 Sequence: DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH Predict reactive species |
| Full Name | CD302 antigen |
| Calculated Molecular Weight | 24 kDa |
| GenBank Accession Number | NM_025422.4 |
| Gene Symbol | Cd302 |
| Gene ID (NCBI) | 66205 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9DCG2-2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242893B2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
