SDHB Monoclonal antibody 67600-1-Ig proteintech
$149.00
In stock
SKU
67600-1-Ig
| Catalog Number | 67600-1-Ig |
| Synonyms | 1A2A5, EC:1.3.5.1, Iron-sulfur subunit of complex II, PGL 4, PGL4 |
| Host | Mouse |
| Reactivity | human, mouse, rat, pig and More (1) |
| Reactivity | human, mouse, rat, pig, rabbit |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | U2OS cells, HeLa cells, HepG2 cells, HSC-T6 cells, pig brain tissue, HEK-293 cells, K-562 cells, NIH/3T3 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue |
| Tested Applications — Positive IHC detected in | mouse skeletal muscle tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human liver cancer tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Positive WB detected in | U2OS cells, HeLa cells, HepG2 cells, HSC-T6 cells, pig brain tissue, HEK-293 cells, K-562 cells, NIH/3T3 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rabbit |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29868 Product name: Recombinant human SDHB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-280 aa of BC007840 Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV Predict reactive species |
| Full Name | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 28-32 kDa |
| GenBank Accession Number | BC007840 |
| Gene Symbol | SDHB |
| Gene ID (NCBI) | 6390 |
| RRID | AB_2882806 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P21912 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SDHB antibody 67600-1-Ig | Download protocol |
| IHC protocol for SDHB antibody 67600-1-Ig | Download protocol |
| WB protocol for SDHB antibody 67600-1-Ig | Download protocol |
| human | IF NPJ Precis Oncol Postnatal sustentacular cells as chromaffin progenitors and tumor cells of origin in VHL-related paragangliomas. Authors - Petra Bullova View Article |
| mouse | WB Chin J Nat Med Mulberry leaf flavonoids activate BAT and induce browning of WAT to improve type 2 diabetes via regulating the AMPK/SIRT1/PGC-1α signaling pathway Authors - Long Cheng View Article |
| Lana (Verified Customer) (08-07-2020) | SDS-PAGE: 20 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:5000.Secondary Ab: IRDye 800CW Goat anti-Mouse, 1:15000.Lines of WB image: 1 – protein ladder, 2 - whole cell lysate, 3 – mitochondrial fraction lysate, 4 – protein ladder. Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: Mouse embryonic stem cells SDHB Antibody Western Blot validation (1:5000 dilution) in Mouse embryonic stem cells (Cat no:67600-1-Ig) |
| Citations | 12 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:1000-1:4000 IF-P : 1:200-1:800 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1A2A5 |
| Conjugation | Unconjugated |
SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS). Protocols Product Specific Protocols IF protocol for SDHB antibody 67600-1-Ig Download protocol IHC protocol for SDHB antibody 67600-1-Ig Download protocol WB protocol for SDHB antibody 67600-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- DMC-BH derivative DMC-GF inhibits the growth of glioma stem cells by targeting the TRIM33/SLC25A1/mitochondrial oxidative phosphorylation pathway
Journal: J Transl Med | Authors: Lei Shi | Species: human | Application: WB - Gut microbiota modified by Mulberry leaf water extract improves T2DM through browning of WAT/BAT activation mediated by SCFAs-AMPK/SIRT1/PGC-1α signaling pathway
Journal: J Ethnopharmacol | Authors: Yuhang Du - Zhen Wu decoction represses renal fibrosis by invigorating tubular NRF2 and TFAM to fuel mitochondrial bioenergetics
Journal: Phytomedicine | Authors: Min Zheng | Species: mouse | Application: WB - Rutin-activated adipose tissue thermogenesis is correlated with increased intestinal short-chain fatty acid levels.
Journal: Phytother Res | Authors: Long Cheng | Species: mouse | Application: WB - Mulberry leaf flavonoids activate BAT and induce browning of WAT to improve type 2 diabetes via regulating the AMPK/SIRT1/PGC-1α signaling pathway
Journal: Chin J Nat Med | Authors: Long Cheng | Species: mouse | Application: WB - Postnatal sustentacular cells as chromaffin progenitors and tumor cells of origin in VHL-related paragangliomas.
Journal: NPJ Precis Oncol | Authors: Petra Bullova | Species: human | Application: IF - Mulberry leaf flavonoids activate BAT and induce browning of WAT to improve type 2 diabetes via regulating the AMPK/SIRT1/PGC-1α signaling pathway
Journal: Chin J Nat Med | Authors: Long Cheng | Species: mouse | Application: WB - Gut microbiota modified by Mulberry leaf water extract improves T2DM through browning of WAT/BAT activation mediated by SCFAs-AMPK/SIRT1/PGC-1α signaling pathway
Journal: J Ethnopharmacol | Authors: Yuhang Du - DL-3-n-Butylphthalide Protects Against PrP(106) (-126)-Induced Neurotoxicity Through NRF2 Signaling and OPA1/DRP1-Mediated Mitochondrial Dynamics.
Journal: CNS Neurosci Ther | Authors: Wei Wu | Species: mouse | Application: WB - Iron supplementation protects against renal ischemia-reperfusion injury by enhancing mitochondrial respiratory complex assembly
Journal: Biochem Pharmacol | Authors: Yuanbo Qi | Application: WB - TRIM47 drives metabolic reprogramming and tumor progression in Nasopharyngeal Carcinoma via K48-linked ubiquitination and degradation of SDHB.
Journal: Cell Mol Life Sci | Authors: Jieqing Yu - LARP1, an RNA-binding protein, participates in ovarian cancer cell survival by regulating mitochondrial oxidative phosphorylation in response to the influence of the PI3K/mTOR pathway
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Jiaoyan Ma | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
