ATG9A Monoclonal antibody 67096-1-Ig proteintech
$149.00
In stock
SKU
67096-1-Ig
| Catalog Number | 67096-1-Ig |
| Synonyms | APG9 like 1, APG9L1, ATG9A, Autophagy related protein 9A, MGD3208 |
| Host | Mouse |
| Reactivity | Human and More (2) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | HEK-293 cells, HepG2 cells, Jurkat cells |
| Tested Applications — Positive IHC detected in | human thyroid cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, HepG2 cells, Jurkat cells |
| Positive IHC detected in | human thyroid cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24278 Product name: Recombinant human ATG9A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 427-528 aa of BC065534 Sequence: DQHMVFCPEQLLRVILAHIHYMPDHWQGVHFGRVAEPHCHTPHPHLLPAPTGPGDYRLLPKLHRGGRWCGRYLLLCSDGCSPAWSSPVAICWADRGLSVPAS Predict reactive species |
| Full Name | ATG9 autophagy related 9 homolog A (S. cerevisiae) |
| Calculated Molecular Weight | 837 aa, 94 kDa |
| Observed Molecular Weight | 94 kDa |
| GenBank Accession Number | BC065534 |
| Gene Symbol | ATG9A |
| Gene ID (NCBI) | 79065 |
| RRID | AB_2882401 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q7Z3C6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for ATG9A antibody 67096-1-Ig | Download protocol |
| IHC protocol for ATG9A antibody 67096-1-Ig | Download protocol |
| WB protocol for ATG9A antibody 67096-1-Ig | Download protocol |
| human,mouse | WB Drug Resist Updat NDRG1 overcomes resistance to immunotherapy of pancreatic ductal adenocarcinoma through inhibiting ATG9A-dependent degradation of MHC-1 Authors - Zhiheng Zhang View Article |
| human | WB NPJ Parkinsons Dis Regulators of proteostasis are translationally repressed in fibroblasts from patients with sporadic and LRRK2-G2019S Parkinson's disease Authors - Dani Flinkman View Article |
| mouse | WB Invest Ophthalmol Vis Sci HSF4 Transcriptionally Activates Autophagy by Regulating ATG9a During Lens Terminal Differentiation Authors - Jing Zhang View Article |
| Citations | 7 |
| Dilutions | WB : 1:2000-1:10000 IHC : 1:300-1:1200 IF/ICC : 1:50-1:500 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1D12E11 |
| Conjugation | Unconjugated |
ATG9A is the only transmembrane ATG protein essential for autophagy. It plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS). It has been reported that ATG9A expression is increased in oral squamous cell carcinoma and breast cancers. The inhibition of ATG9A can lead to an inhibition of cancer cell proliferation and invasion.(PMID: 29437695, 29568063) Protocols Product Specific Protocols IF protocol for ATG9A antibody 67096-1-Ig Download protocol IHC protocol for ATG9A antibody 67096-1-Ig Download protocol WB protocol for ATG9A antibody 67096-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- NDRG1 overcomes resistance to immunotherapy of pancreatic ductal adenocarcinoma through inhibiting ATG9A-dependent degradation of MHC-1
Journal: Drug Resist Updat | Authors: Zhiheng Zhang | Species: human,mouse | Application: WB - Apolipoproteins L1 and L3 control mitochondrial membrane dynamics
Journal: Cell Rep | Authors: Laurence Lecordier | Application: IF - Local membrane source gathering by p62 body drives autophagosome formation
Journal: Nat Commun | Authors: Xuezhao Feng | Species: human | Application: WB,IF - WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway.
Journal: Autophagy | Authors: Danqiong Liu | Species: human | Application: WB,IF - HSF4 Transcriptionally Activates Autophagy by Regulating ATG9a During Lens Terminal Differentiation
Journal: Invest Ophthalmol Vis Sci | Authors: Jing Zhang | Species: mouse | Application: WB - Regulators of proteostasis are translationally repressed in fibroblasts from patients with sporadic and LRRK2-G2019S Parkinson's disease
Journal: NPJ Parkinsons Dis | Authors: Dani Flinkman | Species: human | Application: WB - Suppression of OTUD4 protects against myocardial ischemia-reperfusion injury by increasing autophagic flux and inhibiting apoptosis in cardiomyocytes.
Journal: J Mol Med (Berl) | Authors: Xin-xin Sun | Species: human,mouse | Application: IF
Reviews
Write Your Own Review