CBS Monoclonal antibody 67861-1-Ig proteintech
$149.00
In stock
SKU
67861-1-Ig
| Catalog Number | 67861-1-Ig |
| Synonyms | EC:4.2.1.22, Cystathionine beta-synthase, cystathionine beta synthase, Beta-thionase, Beta thionase |
| Host | Mouse |
| Reactivity | human, rat and More (1) |
| Reactivity | human, rat, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, NCI-H1299 cells, HeLa cells, THP-1 cells |
| Tested Applications — Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, NCI-H1299 cells, HeLa cells, THP-1 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7008 Product name: Recombinant human CBS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-551 aa of BC000440 Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK Predict reactive species |
| Full Name | cystathionine-beta-synthase |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 61-63 kDa |
| GenBank Accession Number | BC000440 |
| Gene Symbol | CBS |
| Gene ID (NCBI) | 875 |
| RRID | AB_2918619 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P35520 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CBS antibody 67861-1-Ig | Download protocol |
| IHC protocol for CBS antibody 67861-1-Ig | Download protocol |
| WB protocol for CBS antibody 67861-1-Ig | Download protocol |
| mouse | WB J Nanobiotechnology NaHS@Cy5@MS@SP nanoparticles improve rheumatoid arthritis by inactivating the Hedgehog signaling pathway through sustained and targeted release of H2S into the synovium Authors - Xue-Xue Zhu View Article |
| rat | WB Biomedicines H(2)S Donor Therapy Reverses Established Pulmonary Arterial Hypertension and Pulmonary Vascular Structural Remodeling in Rats. Authors - Jie Zheng View Article |
| mouse,human | WB Int J Biol Macromol Structure-activity relationship of S-adenosylmethionine analogs as pharmacological chaperones for cystathionine beta-synthase-deficient homocystinuria. Authors - Thilo M. Philipp KO Validated View Article |
| Citations | 8 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:500-1:2000 IF/ICC : 1:400-1:1600 |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 1E4F10 |
| Conjugation | Unconjugated |
The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964). Protocols Product Specific Protocols IF protocol for CBS antibody 67861-1-Ig Download protocol IHC protocol for CBS antibody 67861-1-Ig Download protocol WB protocol for CBS antibody 67861-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- NaHS@Cy5@MS@SP nanoparticles improve rheumatoid arthritis by inactivating the Hedgehog signaling pathway through sustained and targeted release of H2S into the synovium
Journal: J Nanobiotechnology | Authors: Xue-Xue Zhu | Species: mouse | Application: WB - Treatment with aripiprazole and N-acetylcysteine affects anaerobic cysteine metabolism in the hippocampus and reverses schizophrenia-like behavior in the neurodevelopmental rat model of schizophrenia
Journal: FEBS J | Authors: Magdalena Górny | Species: rat | Application: WB - Hydrogen sulfide ameliorated preeclampsia via suppression of toll-like receptor 4-activated inflammation in the rostral ventrolateral medulla of rats.
Journal: Biomed Pharmacother | Authors: Jiexian Du | Species: rat | Application: WB - H(2)S Donor Therapy Reverses Established Pulmonary Arterial Hypertension and Pulmonary Vascular Structural Remodeling in Rats.
Journal: Biomedicines | Authors: Jie Zheng | Species: rat | Application: WB - Structure-activity relationship of S-adenosylmethionine analogs as pharmacological chaperones for cystathionine beta-synthase-deficient homocystinuria.
Journal: Int J Biol Macromol | Authors: Thilo M. Philipp KO Validated | Species: mouse,human | Application: WB - In situ valence-transited arsenic nanosheets for multi-modal therapy of colorectal cancer
Journal: Nat Commun | Authors: Hongyue Zheng - Treatment with aripiprazole and N-acetylcysteine affects anaerobic cysteine metabolism in the hippocampus and reverses schizophrenia-like behavior in the neurodevelopmental rat model of schizophrenia
Journal: FEBS J | Authors: Magdalena Górny | Species: rat | Application: WB - Hydrogen sulfide promotes proliferation and regeneration of human cerebral microvascular endothelial cells via the sonic hedgehog signaling pathway.
Journal: Open Life Sci | Authors: Hai-Yan Chen | Species: human | Application: WB - Misfolding of cystathionine beta-synthase impairs mitochondrial homeostasis and cellular bioenergetics.
Journal: Free Radic Biol Med | Authors: Ela Mijatovic
Reviews
Write Your Own Review