Mouse Cxcl3 Recombinant monoclonal antibody, PBS Only (Detector) 85862-6-PBS proteintech
$699.00
In stock
SKU
85862-6-PBS
| Catalog Number | 85862-6-PBS |
| Synonyms | C-X-C motif chemokine 3, Dcip1, Dendritic cell inflammatory protein 1, Gm1960 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2852 Product name: Recombinant Mouse CXCL3/GRO Gamma protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 28-100 aa of NM_203320.3 Sequence: AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 3 |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_203320.3 |
| Gene Symbol | Cxcl3 |
| Gene ID (NCBI) | 330122 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6W5C0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242889A1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
