CUL4A Monoclonal antibody 66038-1-Ig proteintech
$149.00
In stock
SKU
66038-1-Ig
| Catalog Number | 66038-1-Ig |
| Synonyms | 1A7F12, CUL 4A, CUL-4A, cullin 4A |
| Host | Mouse |
| Reactivity | human, mouse, rat, pig, monkey |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | LNCaP cells, HeLa cells, pig brain tissue, MCF-7 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells |
| Tested Applications — Positive IP detected in | MCF-7 cells |
| Tested Applications — Positive IHC detected in | human heart tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive WB detected in | LNCaP cells, HeLa cells, pig brain tissue, MCF-7 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human heart tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat, pig, monkey |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18089 Product name: Recombinant human CUL4A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 460-759 aa of BC008308 Sequence: RLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA Predict reactive species |
| Full Name | cullin 4A |
| Calculated Molecular Weight | 77 kDa |
| Observed Molecular Weight | 77 kDa, 88 kDa |
| GenBank Accession Number | BC008308 |
| Gene Symbol | CUL4A |
| Gene ID (NCBI) | 8451 |
| RRID | AB_11042446 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q13619 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CUL4A antibody 66038-1-Ig | Download protocol |
| IHC protocol for CUL4A antibody 66038-1-Ig | Download protocol |
| IP protocol for CUL4A antibody 66038-1-Ig | Download protocol |
| WB protocol for CUL4A antibody 66038-1-Ig | Download protocol |
| human | WB,IP Cell Death Differ AMBRA1 promotes intestinal inflammation by antagonizing PP4R1/PP4c mediated IKK dephosphorylation in an autophagy-independent manner Authors - Weimin Xu View Article |
| mouse | WB Cell Death Differ Cullin 4B-RING E3 ligase negatively regulates the immunosuppressive capacity of mesenchymal stem cells by suppressing iNOS Authors - Ruiqi Yu View Article |
| Citations | 5 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 IF/ICC : 1:20-1:200 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1A7F12 |
| Conjugation | Unconjugated |
Cullin proteins assemble a large number of RING E3 ubiquitin ligases, participating in the proteolysis through the ubiquitin-proteasome pathway. Two cullin 4 (CUL4) proteins, CUL4A (87 kDa) and CUL4B(104 kDa), have been identified. The two CUL4 sequences are 83% identical. They target certain proteins for degradation by binding protein DDB1 to form a CUL4-DDB1 ubiquitin ligase complex with DDB. They form two individual E3 ligases, DDB1-CUL4ADDB2 and DDB1-CUL4BDDB2 in this process. CUL4A appeared in both the nucleus and the cytosol, suggesting a more complex mechanism for entering the nucleus. CUL4B is localized in the nucleus and facilitates the transfer of DDB1 into the nucleus independently of DDB2. Protocols Product Specific Protocols IF protocol for CUL4A antibody 66038-1-Ig Download protocol IHC protocol for CUL4A antibody 66038-1-Ig Download protocol IP protocol for CUL4A antibody 66038-1-Ig Download protocol WB protocol for CUL4A antibody 66038-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Temporal Regulation of ESCO2 Degradation by the MCM Complex, the CUL4-DDB1-VPRBP Complex, and the Anaphase-Promoting Complex.
Journal: Curr Biol | Authors: Masashi Minamino | Species: human - GSK3β-driven SOX2 overexpression is a targetable vulnerability in esophageal squamous cell carcinoma
Journal: Oncogene | Authors: Li Kang KD Validated | Species: human | Application: WB - KAP1 phosphorylation promotes the survival of neural stem cells after ischemia/reperfusion by maintaining the stability of PCNA.
Journal: Stem Cell Res Ther | Authors: Wan Wang | Species: mouse | Application: WB,IP,IF - AMBRA1 promotes intestinal inflammation by antagonizing PP4R1/PP4c mediated IKK dephosphorylation in an autophagy-independent manner
Journal: Cell Death Differ | Authors: Weimin Xu | Species: human | Application: WB,IP - Cullin 4B-RING E3 ligase negatively regulates the immunosuppressive capacity of mesenchymal stem cells by suppressing iNOS
Journal: Cell Death Differ | Authors: Ruiqi Yu | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
