DDI2 Polyclonal antibody 25377-1-AP proteintech
$149.00
In stock
SKU
25377-1-AP
| Catalog Number | 25377-1-AP |
| Synonyms | Protein DDI1 homolog 2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HL-60 cells, HUVEC cells |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, HL-60 cells, HUVEC cells |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag21953 Product name: Recombinant human DDI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-62 aa of BC006011 Sequence: DADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLA Predict reactive species |
| Full Name | DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae) |
| Calculated Molecular Weight | 399 aa, 45 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC006011 |
| Gene Symbol | DDI2 |
| Gene ID (NCBI) | 84301 |
| RRID | AB_3669472 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5TDH0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for DDI2 antibody 25377-1-AP | Download protocol |
| WB protocol for DDI2 antibody 25377-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:12000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
DDI2 contains 399 amino acids and contains an N-terminal ubiquitin-like (UBL) domain and a highly conserved retroviral protease-like (RVP) domain. DDI2 is an aspartic endoprotease that cleaves ubiquitylated target proteins to assist in their processing by the ubiquitin-proteasome system (UPS), especially when the UPS is inhibited(PMID: 32521225). Protocols Product Specific Protocols IF protocol for DDI2 antibody 25377-1-AP Download protocol WB protocol for DDI2 antibody 25377-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
