CCRL2 Monoclonal antibody 66611-1-Ig proteintech
$149.00
In stock
SKU
66611-1-Ig
| Catalog Number | 66611-1-Ig |
| Synonyms | C C chemokine receptor like 2, CCR11, CCR6, CCRL2, Chemokine receptor CCR11, Chemokine receptor X, CKRX, CRAM, CRAM A, CRAM B, HCR |
| Host | Mouse |
| Reactivity | Human and More (1) |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | HeLa cells, K-562 cells |
| Tested Applications — Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Positive WB detected in | HeLa cells, K-562 cells |
| Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4045 Product name: Recombinant human CCRL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-344 aa of BC025717 Sequence: MWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV Predict reactive species |
| Full Name | chemokine (C-C motif) receptor-like 2 |
| Calculated Molecular Weight | 344 aa, 40 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC025717 |
| Gene Symbol | CCRL2 |
| Gene ID (NCBI) | 9034 |
| RRID | AB_2881971 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | O00421 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CCRL2 antibody 66611-1-Ig | Download protocol |
| WB protocol for CCRL2 antibody 66611-1-Ig | Download protocol |
| human | WB Front Immunol Identification and validation of chemokine system-related genes in idiopathic pulmonary fibrosis Authors - Tianming Zhao View Article |
| Citations | 5 |
| Dilutions | WB : 1:1000-1:6000 IHC : 1:400-1:1600 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2C1E11 |
| Conjugation | Unconjugated |
Chemokine CC motif receptor-like 2 (CCRL2) is a seven-transmembrane domain receptor that shares structural and functional similarities with the family of atypical chemokine receptors (ACKRs) (PMID: 28743719). CCRL2 does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. CCRL2 has been found on almost all hemopoietic cells, including monocytes, macrophages, polymorphonuclear neutrophils (PMNs), T cells, dendritic cells, natural killer cells, and CD34+ progenitor cells, with PMNs expressing the highest levels (PMID: 15188357). CCRL2 is also expressed by barrier cells, such as lymphatic and blood endothelial cells and bronchial and intestinal epithelial cells (PMID: 29056935). Protocols Product Specific Protocols IHC protocol for CCRL2 antibody 66611-1-Ig Download protocol WB protocol for CCRL2 antibody 66611-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Statins Prevent the Deleterious Consequences of Placental Chemerin Upregulation in Preeclampsia
Journal: Hypertension | Authors: Lunbo Tan | Species: human | Application: WB - Identification of viral SIM-SUMO2-interaction inhibitors for treating primary effusion lymphoma.
Journal: PLoS Pathog | Authors: Ling Ding | Species: human | Application: WB - Oncogenic Role and Prognostic Value of MicroRNA-937-3p in Patients with Breast Cancer.
Journal: Onco Targets Ther | Authors: Deyu Li | Species: human | Application: WB - Macrophage NPM1 drives anti-tumor immunity via the STAT3-CCRL2 axis.
Journal: Front Immunol | Authors: Lei Hong - Identification and validation of chemokine system-related genes in idiopathic pulmonary fibrosis
Journal: Front Immunol | Authors: Tianming Zhao | Species: human | Application: WB
Reviews
Write Your Own Review