DDX60 Recombinant monoclonal antibody, PBS Only 83286-1-PBS proteintech
$699.00
In stock
SKU
83286-1-PBS
| Catalog Number | 83286-1-PBS |
| Synonyms | DEAD box protein 60, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX60 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34626 Product name: Recombinant human DDX60 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1135-1250 aa of BC038115 Sequence: KLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKG Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 |
| Calculated Molecular Weight | 1712 aa, 198 kDa |
| GenBank Accession Number | BC038115 |
| Gene Symbol | DDX60 |
| Gene ID (NCBI) | 55601 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IY21 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240198B3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
