DGAT1 Recombinant monoclonal antibody, PBS Only 82945-1-PBS proteintech
$699.00
In stock
SKU
82945-1-PBS
| Catalog Number | 82945-1-PBS |
| Synonyms | DGAT, ARAT, AGRP1, Acyl-CoA retinol O-fatty-acyltransferase, ACAT-related gene product 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, Indirect ELISA |
| Applications | WB, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag32717 Product name: Recombinant human DGAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-300 aa of BC015762 Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM Predict reactive species |
| Full Name | diacylglycerol O-acyltransferase homolog 1 (mouse) |
| Calculated Molecular Weight | 488 aa, 55 kDa |
| GenBank Accession Number | BC015762 |
| Gene Symbol | DGAT1 |
| Gene ID (NCBI) | 8694 |
| RRID | AB_3391728 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O75907 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | 1 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230091E1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
