DICER1 Monoclonal antibody 68375-1-Ig proteintech
$149.00
In stock
SKU
68375-1-Ig
| Catalog Number | 68375-1-Ig |
| Synonyms | 1C8E2, DCR1, DICER, EC:3.1.26.3, Endoribonuclease Dicer |
| Host | Mouse |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, chicken |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, IP, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, Ramos cells, Sp2/0 cells |
| Tested Applications — Positive IP detected in | Jurkat cells |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, Ramos cells, Sp2/0 cells |
| Positive IP detected in | Jurkat cells |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | chicken |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30368 Product name: Recombinant human DICER1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 432-534 aa of NM_030621 Sequence: TNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLV Predict reactive species |
| Full Name | dicer 1, ribonuclease type III |
| Calculated Molecular Weight | 219 kDa |
| Observed Molecular Weight | 240-250 kDa |
| GenBank Accession Number | NM_030621 |
| Gene Symbol | DICER1 |
| Gene ID (NCBI) | 23405 |
| RRID | AB_3085094 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9UPY3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for DICER1 antibody 68375-1-Ig | Download protocol |
| IP protocol for DICER1 antibody 68375-1-Ig | Download protocol |
| WB protocol for DICER1 antibody 68375-1-Ig | Download protocol |
| chicken | WB PLoS Pathog Avian leukosis virus subgroup J evades innate immunity by activating miR-155 to dually target TRAF3 and STAT1. Authors - Xinyue Zhang View Article |
| Aleksandr (Verified Customer) (11-10-2024) | Great antibody, that were used to probe for Dicer1 in human RKO cells Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: RKO DICER1 Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:68375-1-Ig) |
| Tsimafei (Verified Customer) (08-07-2024) | Excellent antibody for Dicer1 Applications: Western Blot Primary Antibody Dilution: 1:3000 Cell Tissue Type: mESCs DICER1 Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:68375-1-Ig) |
| Laurens (Verified Customer) (08-01-2023) | Antibody worked excellently on western blot. On par or even better than the D38E7 antibody from Cell Signalling, despite using a lower dilution of the Proteintech antibody. Will turn out to be a cheaper and better alternative. Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: HEK293 DICER1 Antibody Western Blot validation (1:2000 dilution) in HEK293 (Cat no:68375-1-Ig) |
| Citations | 2 |
| Dilutions | WB : 1:1000-1:6000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF/ICC : 1:400-1:1600 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1C8E2 |
| Conjugation | Unconjugated |
DICER1 functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. DICER1 cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, and producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Protocols Product Specific Protocols IF protocol for DICER1 antibody 68375-1-Ig Download protocol IP protocol for DICER1 antibody 68375-1-Ig Download protocol WB protocol for DICER1 antibody 68375-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Avian leukosis virus subgroup J evades innate immunity by activating miR-155 to dually target TRAF3 and STAT1.
Journal: PLoS Pathog | Authors: Xinyue Zhang | Species: chicken | Application: WB - Extracellular vesicles derived from senescent hepatocytes drive pan-cancer metastasis in aging
Journal: Nat Aging | Authors: Huilong Li
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
