DNMT3B Monoclonal antibody, PBS Only (Capture) 68919-6-PBS proteintech
$699.00
In stock
SKU
68919-6-PBS
| Catalog Number | 68919-6-PBS |
| Synonyms | DNA (cytosine-5)-methyltransferase 3B, DNMT, DNMT3, EC:2.1.1.37, ICF |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag33907 Product name: Recombinant human DNMT3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001207055 Sequence: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES Predict reactive species |
| Full Name | DNA (cytosine-5-)-methyltransferase 3 beta |
| Calculated Molecular Weight | 95 kDa |
| GenBank Accession Number | NM_001207055 |
| Gene Symbol | DNMT3B |
| Gene ID (NCBI) | 1789 |
| Conjugate | Unconjugated |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q9UBC3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 1F12B3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
