CD24 Monoclonal antibody 67627-1-Ig proteintech
$149.00
In stock
SKU
67627-1-Ig
| Catalog Number | 67627-1-Ig |
| Synonyms | 1H5C4, CD24A |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Applications | WB, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | MCF-7 cells, Raji cells, Ramos cells, Daudi cells, Jurkat cells, K-562 cells, HL-60 cells |
| Tested Applications — Positive IF/ICC detected in | Daudi cells |
| Tested Applications — Positive FC (Intra) detected in | Ramos cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | MCF-7 cells, Raji cells, Ramos cells, Daudi cells, Jurkat cells, K-562 cells, HL-60 cells |
| Positive IF/ICC detected in | Daudi cells |
| Positive FC (Intra) detected in | Ramos cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag11679 Product name: Recombinant human CD24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species |
| Full Name | CD24 molecule |
| Calculated Molecular Weight | 8 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC007674 |
| Gene Symbol | CD24 |
| Gene ID (NCBI) | 100133941 |
| RRID | AB_2882828 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P25063 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for CD24 antibody 67627-1-Ig | Download protocol |
| IF protocol for CD24 antibody 67627-1-Ig | Download protocol |
| WB protocol for CD24 antibody 67627-1-Ig | Download protocol |
| human | IF Exp Mol Med (Non)canonical Wnt signaling, cytoarchitecture and stemness: new insights from primary nonmetastatic, primary metastatic, regional and distant metastatic models of adrenocortical carcinoma. Authors - Igor Shapiro View Article |
| Citations | 10 |
| Dilutions | WB : 1:5000-1:50000 IF/ICC : 1:200-1:800 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1H5C4 |
| Conjugation | Unconjugated |
CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009) Protocols Product Specific Protocols FC protocol for CD24 antibody 67627-1-Ig Download protocol IF protocol for CD24 antibody 67627-1-Ig Download protocol WB protocol for CD24 antibody 67627-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Anti-CD24 antibody-nitric oxide donor conjugates bearing a self-bioorthogonal cleavable linker.
Journal: Acta Pharm Sin B | Authors: Jianbing Wu | Species: human | Application: IHC - Targeted degradation of CD24 by a transferrin receptor-engaging bispecific degrader enhances antitumor immunity.
Journal: Biochem Pharmacol | Authors: Maorong Zhu - CD24 overexpression confers resistance to Pyrotinib through inhibiting autophagy in patients with HER2-positive breast cancer.
Journal: Int J Biol Macromol | Authors: Yue Gao - Co-expression of cancer stem cell markers CD24 and CD133 in gastric cancer tissues: Clinicopathological and prognostic significance.
Journal: World J Stem Cells | Authors: Cheng-Xian Ma | Species: human | Application: IHC - (Non)canonical Wnt signaling, cytoarchitecture and stemness: new insights from primary nonmetastatic, primary metastatic, regional and distant metastatic models of adrenocortical carcinoma.
Journal: Exp Mol Med | Authors: Igor Shapiro | Species: human | Application: IF - Clonorchis sinensis-driven hepatocarcinogenesis via E2F1-CD24 transcriptional axis: mechanistic and therapeutic implications
Journal: Parasit Vectors | Authors: Wen-Min Lu
Reviews
Write Your Own Review