EEF1A1 Monoclonal antibody 67495-1-Ig proteintech
$149.00
In stock
SKU
67495-1-Ig
| Catalog Number | 67495-1-Ig |
| Synonyms | 1A9F5, CCS 3, CCS3, EC:3.6.5.-, EEF 1 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells |
| Tested Applications — Positive IHC detected in | human pancreas cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Tested Applications — Positive FC (Intra) detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | human pancreas cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1938 Product name: Recombinant human EEF1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-462 aa of BC014224 Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK Predict reactive species |
| Full Name | eukaryotic translation elongation factor 1 alpha 1 |
| Calculated Molecular Weight | 462 aa, 50 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC014224 |
| Gene Symbol | EEF1A1 |
| Gene ID (NCBI) | 1915 |
| RRID | AB_2882719 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P68104 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for EEF1A1 antibody 67495-1-Ig | Download protocol |
| IF protocol for EEF1A1 antibody 67495-1-Ig | Download protocol |
| IHC protocol for EEF1A1 antibody 67495-1-Ig | Download protocol |
| WB protocol for EEF1A1 antibody 67495-1-Ig | Download protocol |
| human | IF Biol Direct UCHL3 promotes hepatocellular carcinoma progression by stabilizing EEF1A1 through deubiquitination Authors - Jie Zhao View Article |
| Citations | 5 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:150-1:600 IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1A9F5 |
| Conjugation | Unconjugated |
EEF1A1, also named as EEF1A, EF1A and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. It is a typical housekeeping gene product required for the maintenance of cell proliferation and/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved. Protocols Product Specific Protocols FC protocol for EEF1A1 antibody 67495-1-Ig Download protocol IF protocol for EEF1A1 antibody 67495-1-Ig Download protocol IHC protocol for EEF1A1 antibody 67495-1-Ig Download protocol WB protocol for EEF1A1 antibody 67495-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A photoaffinity labeling strategy identified EF1A1 as a binding protein of cyclic dinucleotide 2'3'-cGAMP.
Journal: Cell Chem Biol | Authors: Yingjie Hou | Species: human | Application: WB - Protocol for identification and validation of 2'3'-cGAMP-binding proteins by photoaffinity probes.
Journal: STAR Protoc | Authors: Yingjie Hou | Species: human | Application: WB,IP - UCHL3 promotes hepatocellular carcinoma progression by stabilizing EEF1A1 through deubiquitination
Journal: Biol Direct | Authors: Jie Zhao | Species: human | Application: IF - Coordinated regulation of mRNA translation and stability by ZC3H7A and ZC3H7B RNA-binding proteins.
Journal: Cell Rep | Authors: Patric Harris Snell - Novel CDK-independent function of CDC25 phosphatases in mRNA translation.
Journal: EMBO Rep | Authors: Sauyeun Shin
Reviews
Write Your Own Review