EDDM3B Recombinant monoclonal antibody, PBS Only (Detector) 84597-3-PBS proteintech
$699.00
In stock
SKU
84597-3-PBS
| Catalog Number | 84597-3-PBS |
| Synonyms | Epididymal secretory protein E3-beta, FAM12B, HE3B, HE3-beta, Human epididymis-specific protein 3-beta |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2443 Product name: Recombinant Human EDDM3B protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-147 aa of NM_022360.5 Sequence: KEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLKMVEPIGN Predict reactive species |
| Full Name | family with sequence similarity 12, member B (epididymal) |
| Calculated Molecular Weight | 18kDa |
| GenBank Accession Number | NM_022360.5 |
| Gene Symbol | FAM12B |
| Gene ID (NCBI) | 64184 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P56851 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241998B11 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
