EIF2C4 Recombinant monoclonal antibody, PBS Only (Capture/Detector) 83035-1-PBS proteintech
$699.00
In stock
SKU
83035-1-PBS
| Catalog Number | 83035-1-PBS |
| Synonyms | AGO4, Argonaute RISC catalytic component 4, Argonaute4, eIF-2C 4, KIAA1567 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag19211 Product name: Recombinant human EIF2C4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-151 aa of BC152450 Sequence: NMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQA Predict reactive species |
| Full Name | eukaryotic translation initiation factor 2C, 4 |
| Calculated Molecular Weight | 861 aa, 97 kDa |
| GenBank Accession Number | BC152450 |
| Gene Symbol | EIF2C4 |
| Gene ID (NCBI) | 192670 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9HCK5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230265A5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
