PGAM5 Monoclonal antibody 68116-1-Ig proteintech
$149.00
In stock
SKU
68116-1-Ig
| Catalog Number | 68116-1-Ig |
| Synonyms | 1C8B9, Bcl-XL-binding protein v68, BXLBv68, EC:3.1.3.16, Serine/threonine-protein phosphatase PGAM5, mitochondrial |
| Host | Mouse |
| Reactivity | human, mouse, rat, pig, rabbit |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | LNCaP cells, rabbit brain tissue, pig brain tissue, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | LNCaP cells, rabbit brain tissue, pig brain tissue, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat, pig |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag28195 Product name: Recombinant human PGAM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-255 aa of BC008196 Sequence: MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPPLLSAGDFVVLGS Predict reactive species |
| Full Name | phosphoglycerate mutase family member 5 |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC008196 |
| Gene Symbol | PGAM5 |
| Gene ID (NCBI) | 192111 |
| RRID | AB_2923645 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q96HS1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for PGAM5 antibody 68116-1-Ig | Download protocol |
| rat | WB,IF Biomed Pharmacother Effects of dapagliflozin monotherapy and combined aerobic exercise on skeletal muscle mitochondrial quality control and insulin resistance in type 2 diabetes mellitus rats Authors - Liangzhi Zhang View Article |
| mouse | WB J Physiol Biochem Aerobic exercise improve physical endurance and muscle function by ameliorating oxidative stress and modulating mitochondrial dynamics in aged skeletal muscle. Authors - Fengting Ting Zheng View Article |
| pig | WB,IF Research (Wash D C) Lycopene Alleviates Deoxynivalenol-Induced Porcine Intestinal Epithelial Barrier Injury by Inhibiting PGAM5-Mediated Mitophagy-Dependent Ferroptosis. Authors - Jing Zheng View Article |
| Citations | 10 |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1C8B9 |
| Conjugation | Unconjugated |
Phosphoglycerate mutase 5 (PGAM5) is a mitochondrial Serine (Ser)/Threonine (Thr) phosphatase normally located in the inner mitochondrial membrane. Upon mitochondrial dysfunction, PGAM5 recruits and dephosphorylates Drp1 at Ser-637, triggers its GTPase activity and promotes mitochondrial fission. PGAM5 regulates mitophagy by stabilizing PINK1 under stress conditions, which recruits E3 ubiquitin ligase PARKIN for degradation of the damaged mitochondria. PGAM5 can be cleaved and released to the cytoplasm through PARKIN, which activates Wnt signaling and induces mitochondrial biogenesis (PMID: 32439975). PGAM5 has 2 isoforms with the molecular mass of 28 and 32 kDa. Protocols Product Specific Protocols WB protocol for PGAM5 antibody 68116-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Effects of dapagliflozin monotherapy and combined aerobic exercise on skeletal muscle mitochondrial quality control and insulin resistance in type 2 diabetes mellitus rats
Journal: Biomed Pharmacother | Authors: Liangzhi Zhang | Species: rat | Application: WB,IF - Chuanxiong-Danggui herb pair alleviated cognitive deficits of APP/PS1 mice by promoting mitophagy
Journal: J Ethnopharmacol | Authors: Keting Pu - Notoginsenoside R1 interferes with PGAM5-NEK7 interaction to inhibit NLRP3 inflammasome activation in macrophages and ameliorate DSS-induced colitis.
Journal: J Ethnopharmacol | Authors: Qianqian Du - Cleaving PINK1 or PGAM5? Involvement of PARL in Methamphetamine-Induced Excessive Mitophagy and Neuronal Necroptosis
Journal: CNS Neurosci Ther | Authors: Di An | Species: mouse | Application: IF - Lycopene Alleviates Deoxynivalenol-Induced Porcine Intestinal Epithelial Barrier Injury by Inhibiting PGAM5-Mediated Mitophagy-Dependent Ferroptosis.
Journal: Research (Wash D C) | Authors: Jing Zheng | Species: pig | Application: WB,IF - Aerobic exercise improve physical endurance and muscle function by ameliorating oxidative stress and modulating mitochondrial dynamics in aged skeletal muscle.
Journal: J Physiol Biochem | Authors: Fengting Ting Zheng | Species: mouse | Application: WB - Notoginsenoside R1 interferes with PGAM5-NEK7 interaction to inhibit NLRP3 inflammasome activation in macrophages and ameliorate DSS-induced colitis.
Journal: J Ethnopharmacol | Authors: Qianqian Du - Cleaving PINK1 or PGAM5? Involvement of PARL in Methamphetamine-Induced Excessive Mitophagy and Neuronal Necroptosis
Journal: CNS Neurosci Ther | Authors: Di An | Species: mouse | Application: IF - Aerobic exercise improve physical endurance and muscle function by ameliorating oxidative stress and modulating mitochondrial dynamics in aged skeletal muscle.
Journal: J Physiol Biochem | Authors: Fengting Ting Zheng | Species: mouse | Application: WB - PGAM5 modulates PI3K/AKT/mTOR-dependent mitochondrial homeostasis in sepsis-induced acute kidney injury.
Journal: Toxicol Appl Pharmacol | Authors: Xianglan Jin | Species: rat | Application: IHC
Product Documents
Reviews
Write Your Own Review