PRDX4 Monoclonal antibody 60286-1-Ig proteintech
$149.00
In stock
SKU
60286-1-Ig
| Catalog Number | 60286-1-Ig |
| Synonyms | Antioxidant enzyme AOE372, AOE37 2, AOE37-2, EC:1.11.1.24, peroxiredoxin 4 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | LNCaP cells, NIH/3T3 cells, HeLa cells, HepG2 cells, K-562 cells, PC-12 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells |
| Tested Applications — Positive IHC detected in | human colon tissue, human pancreas cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | LNCaP cells, NIH/3T3 cells, HeLa cells, HepG2 cells, K-562 cells, PC-12 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells |
| Positive IHC detected in | human colon tissue, human pancreas cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag13401 Product name: Recombinant human PRDX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-271 aa of BC007107 Sequence: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN Predict reactive species |
| Full Name | peroxiredoxin 4 |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC007107 |
| Gene Symbol | PRDX4 |
| Gene ID (NCBI) | 10549 |
| RRID | AB_2881403 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13162 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PRDX4 antibody 60286-1-Ig | Download protocol |
| IHC protocol for PRDX4 antibody 60286-1-Ig | Download protocol |
| WB protocol for PRDX4 antibody 60286-1-Ig | Download protocol |
| human | WB Nat Commun The deubiquitinase OTUD1 regulates immunoglobulin production and proteasome inhibitor sensitivity in multiple myeloma Authors - Alexander Vdovin KD Validated View Article |
| mouse | IF Biochem Biophys Res Commun Peroxiredoxin 4 secreted by cumulus cells ameliorates the maturation of oocytes in vitro Authors - Wangjuan Dai View Article |
| mouse,human | IF Clin Cosmet Investig Dent Integrative MultiOmics and Machine Learning Reveal Peroxiredoxin 4 as a Critical Hub Governing Mitochondrial Dysfunction and B Cell Differentiation in Periodontitis. Authors - Congyi Tu View Article |
| Citations | 5 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:20-1:200 IF/ICC : 1:400-1:1600 |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 5B6F1 |
| Conjugation | Unconjugated |
PRDX4(Peroxiredoxin-4) is also named as AOE37-2, Prx-IV and belongs to the AhpC/TSA family. PRDX4 is associated with acrosome formation during rat spermatogenesis and has a protective role in the male reproductive tract, because the phenotype of mice lacking this isoform includes testicular atrophy and increased sperm DNA damage(PMID:20864641). It is initially synthesized as a membrane-binding 31-kDa protein and processed into a 27-kDa secretory form and is discarded with the residual bodies(PMID:19208552). PRDX4 is a pentamer of dimers(PMID:23025503). Protocols Product Specific Protocols IF protocol for PRDX4 antibody 60286-1-Ig Download protocol IHC protocol for PRDX4 antibody 60286-1-Ig Download protocol WB protocol for PRDX4 antibody 60286-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The deubiquitinase OTUD1 regulates immunoglobulin production and proteasome inhibitor sensitivity in multiple myeloma
Journal: Nat Commun | Authors: Alexander Vdovin KD Validated | Species: human | Application: WB - Exosome-Related FTCD Facilitates M1 Macrophage Polarization and Impacts the Prognosis of Hepatocellular Carcinoma
Journal: Biomolecules | Authors: Youyi Liu | Species: mouse | Application: WB - Nrf2 maintains reactive oxygen species at an optimal level during endoplasmic reticulum stress in HT22 cells.
Journal: Eur J Cell Biol | Authors: Yoko Hirata | Species: mouse | Application: WB - Peroxiredoxin 4 secreted by cumulus cells ameliorates the maturation of oocytes in vitro
Journal: Biochem Biophys Res Commun | Authors: Wangjuan Dai | Species: mouse | Application: IF - Integrative MultiOmics and Machine Learning Reveal Peroxiredoxin 4 as a Critical Hub Governing Mitochondrial Dysfunction and B Cell Differentiation in Periodontitis.
Journal: Clin Cosmet Investig Dent | Authors: Congyi Tu | Species: mouse,human | Application: IF
Reviews
Write Your Own Review