EMC7/C15orf24 Monoclonal antibody 68722-2-Ig proteintech
$149.00
In stock
SKU
68722-2-Ig
| Catalog Number | 68722-2-Ig |
| Synonyms | C11orf3, C15orf24, HT022, ORF1 FL1, UNQ905/PRO1926, UPF0480 protein C15orf24 |
| Host | Mouse |
| Reactivity | Human, Mouse , Rat |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | HSC-T6 cells, LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, U2OS cells, NIH/3T3 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | HSC-T6 cells, LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, U2OS cells, NIH/3T3 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | Human, Mouse , Rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26813 Product name: Recombinant human C15orf24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-159 aa of BC104934 Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD Predict reactive species |
| Full Name | chromosome 15 open reading frame 24 |
| Observed Molecular Weight | 20-26 kDa |
| GenBank Accession Number | BC104934 |
| Gene Symbol | EMC7 |
| Gene ID (NCBI) | 56851 |
| RRID | AB_3670415 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NPA0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for EMC7/C15orf24 antibody 68722-2-Ig | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 1A10E1 |
| Conjugation | Unconjugated |
The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Protocols Product Specific Protocols WB protocol for EMC7/C15orf24 antibody 68722-2-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
