Vitronectin/S-protein Monoclonal antibody 66398-1-Ig proteintech
$149.00
In stock
SKU
66398-1-Ig
| Catalog Number | 66398-1-Ig |
| Synonyms | 1D2C8, Serum-spreading factor, Somatomedin-B, S-protein, V75 |
| Host | Mouse |
| Reactivity | human, mouse, pig, rabbit |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | human plasma tissue, pig plasma tissue, rabbit serum tissue |
| Tested Applications — Positive IHC detected in | human testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | NIH/3T3 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:10000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | human plasma tissue, pig plasma tissue, rabbit serum tissue |
| Positive IHC detected in | human testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
| Western Blot (WB) | WB : 1:10000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, pig, rabbit |
| Cited Reactivity | human, mouse, pig |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8443 Product name: Recombinant human VTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-478 aa of BC005046 Sequence: EVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL Predict reactive species |
| Full Name | vitronectin |
| Calculated Molecular Weight | 478 aa, 54 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC005046 |
| Gene Symbol | VTN |
| Gene ID (NCBI) | 7448 |
| RRID | AB_2881772 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P04004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Vitronectin/S-protein antibody 66398-1-Ig | Download protocol |
| IHC protocol for Vitronectin/S-protein antibody 66398-1-Ig | Download protocol |
| WB protocol for Vitronectin/S-protein antibody 66398-1-Ig | Download protocol |
| mouse | IF Int J Mol Sci Using Cancer-Associated Fibroblasts as a Shear-Wave Elastography Imaging Biomarker to Predict Anti-PD-1 Efficacy of Triple-Negative Breast Cancer Authors - Zhiming Zhang View Article |
| pig | IHC Int J Mol Sci Large-Scale Protein Analysis of Experimental Retinal Artery Occlusion Authors - Nanna Vestergaard View Article |
| human | WB NPJ Biofilms Microbiomes Clostridium difficile-derived membrane vesicles promote fetal growth restriction via inhibiting trophoblast motility through PPARγ/RXRα/ANGPTL4 axis Authors - Zhiqiang Zha View Article |
| Citations | 5 |
| Dilutions | WB : 1:10000-1:50000 IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1D2C8 |
| Conjugation | Unconjugated |
Vitronectin is a glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588). Protocols Product Specific Protocols IF protocol for Vitronectin/S-protein antibody 66398-1-Ig Download protocol IHC protocol for Vitronectin/S-protein antibody 66398-1-Ig Download protocol WB protocol for Vitronectin/S-protein antibody 66398-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Using Cancer-Associated Fibroblasts as a Shear-Wave Elastography Imaging Biomarker to Predict Anti-PD-1 Efficacy of Triple-Negative Breast Cancer
Journal: Int J Mol Sci | Authors: Zhiming Zhang | Species: mouse | Application: IF - Angiogenic Prognostic Signature for Stratification in Hepatocellular Carcinoma.
Journal: J Hepatocell Carcinoma | Authors: Zhanwei Zhu - ESM1 SUMOylation mediates bevacizumab resistance in ovarian cancer through ITGB1-FAK-driven angiogenesis.
Journal: Cell Rep | Authors: Xiaomin Ran - Large-Scale Protein Analysis of Experimental Retinal Artery Occlusion
Journal: Int J Mol Sci | Authors: Nanna Vestergaard | Species: pig | Application: IHC - Clostridium difficile-derived membrane vesicles promote fetal growth restriction via inhibiting trophoblast motility through PPARγ/RXRα/ANGPTL4 axis
Journal: NPJ Biofilms Microbiomes | Authors: Zhiqiang Zha | Species: human | Application: WB
Reviews
Write Your Own Review