EPHX4 Polyclonal antibody 25565-1-AP proteintech
$149.00
In stock
SKU
25565-1-AP
| Catalog Number | 25565-1-AP |
| Synonyms | ABHD7, EPHX4, EPHXRP, epoxide hydrolase 4 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | MCF-7 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag22238 Product name: Recombinant human EPHX4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 175-264 aa of BC041475 Sequence: AWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAY Predict reactive species |
| Full Name | epoxide hydrolase 4 |
| Calculated Molecular Weight | 362 aa, 42 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC041475 |
| Gene Symbol | EPHX4 |
| Gene ID (NCBI) | 253152 |
| RRID | AB_3085805 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IUS5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for EPHX4 antibody 25565-1-AP | Download protocol |
| human | WB Gene Exploring the functional and prognostic roles of EPHX4 in pancreatic cancer: Insights from bioinformatics and experimental validation Authors - Shaoyang Huang KD Validated View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
EPHX4 (Epoxide Hydrolase 4) is a protein coding gene and localized almost exclusively on the surface of lipid droplets(PMID:25523620). Protocols Product Specific Protocols WB protocol for EPHX4 antibody 25565-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Exploring the functional and prognostic roles of EPHX4 in pancreatic cancer: Insights from bioinformatics and experimental validation
Journal: Gene | Authors: Shaoyang Huang KD Validated | Species: human | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
