EPO/Erythropoietin Recombinant monoclonal antibody, PBS Only (Detector) 83762-2-PBS proteintech
$699.00
In stock
SKU
83762-2-PBS
| Catalog Number | 83762-2-PBS |
| Synonyms | EPO, EP, Epoetin, erythropoietin, MVCD2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0197 Product name: Recombinant Human EPO/Erythropoietin protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: C-6*His Domain: 28-193 aa of BC093628 Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Predict reactive species |
| Full Name | erythropoietin |
| Calculated Molecular Weight | 193 aa, 21 kDa |
| GenBank Accession Number | BC093628 |
| Gene Symbol | EPO/Erythropoietin |
| Gene ID (NCBI) | 2056 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P01588 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240773D3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
