ER Recombinant monoclonal antibody, PBS Only (Detector) 84564-8-PBS proteintech
$699.00
In stock
SKU
84564-8-PBS
| Catalog Number | 84564-8-PBS |
| Synonyms | ESR1, ER alpha, Era, ER-alpha, ERα |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2234 Product name: Recombinant Human ER protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-116 aa of BC128573 Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ Predict reactive species |
| Full Name | estrogen receptor 1 |
| Calculated Molecular Weight | 595 aa, 66 kDa |
| GenBank Accession Number | BC128573 |
| Gene Symbol | ER |
| Gene ID (NCBI) | 2099 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P03372 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250324G1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
