XPG Polyclonal antibody 11331-1-AP proteintech
$149.00
In stock
SKU
11331-1-AP
| Catalog Number | 11331-1-AP |
| Synonyms | ERCC5, COFS3, DNA excision repair protein ERCC-5, DNA repair protein complementing XP-G cells, EC:3.1.-.- |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, Daudi cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive WB detected in | HeLa cells, HepG2 cells, Daudi cells |
| Positive IP detected in | HeLa cells |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1874 Product name: Recombinant human ERCC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 880-1186 aa of BC031522 Sequence: EFPGHGLEPLLKFSEWWHEAQKNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT Predict reactive species |
| Full Name | excision repair cross-complementing rodent repair deficiency, complementation group 5 |
| Calculated Molecular Weight | 1186 aa, 133 kDa |
| Observed Molecular Weight | 200 kDa |
| GenBank Accession Number | BC031522 |
| Gene Symbol | ERCC5 |
| Gene ID (NCBI) | 2073 |
| RRID | AB_2098155 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P28715 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for XPG antibody 11331-1-AP | Download protocol |
| IP protocol for XPG antibody 11331-1-AP | Download protocol |
| WB protocol for XPG antibody 11331-1-AP | Download protocol |
| human | WB Biochim Biophys Acta Stimulation of ribosomal RNA gene promoter by transcription factor Sp1 involves active DNA demethylation by Gadd45-NER pathway. Authors - Pallavi Rajput View Article |
| Citations | 16 |
| Dilutions | WB : 1:500-1:3000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF/ICC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The human genes correcting DNA repair defects are termed excision-repair cross-complementing or ERCC genes. The ERCC5 gene corrects the excision repair deficiency of Chinese hamster ovary cell line UV135 of complementation group 5. The human ERCC5 gene product is a structure-specific endonuclease required for making the 3-prime incision during DNA nucleotide excision-repair (NER). It also plays an important role in regulating DNA excision repair, removal of bulky lesions caused by environmental chemicals or UV light [PMID:22815677]. The calculated molecular weight of ERCC5 is 133 kDa, but the modified ERCC5 protein is about 200 kDa. Protocols Product Specific Protocols IF protocol for XPG antibody 11331-1-AP Download protocol IP protocol for XPG antibody 11331-1-AP Download protocol WB protocol for XPG antibody 11331-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Human Rad52 Promotes XPG-Mediated R-loop Processing to Initiate Transcription-Associated Homologous Recombination Repair.
Journal: Cell | Authors: Takaaki Yasuhara KD Validated | Species: human | Application: WB - Systematic Functional Annotation of Somatic Mutations in Cancer.
Journal: Cancer Cell | Authors: Patrick Kwok-Shing Ng | Species: human - Associations between Expression Levels of Nucleotide Excision Repair Proteins in Lymphoblastoid Cells and Risk of Squamous Cell Carcinoma of the Head and Neck.
Journal: Mol Carcinog | Authors: Peng Han - Characterization of the nucleotide excision repair pathway and evaluation of compounds for overcoming the cisplatin resistance of non‑small cell lung cancer cell lines.
Journal: Oncol Rep | Authors: Toshihiro Suzuki KD Validated | Species: human | Application: WB - PMID: 31772670
Journal: J Cancer | Authors: Li-Ming Tan | Species: human | Application: WB - Stimulation of ribosomal RNA gene promoter by transcription factor Sp1 involves active DNA demethylation by Gadd45-NER pathway.
Journal: Biochim Biophys Acta | Authors: Pallavi Rajput | Species: human | Application: WB - Differential effects of mercury compounds on mutagenicity, genotoxicity and repair of UV-DNA damage
Journal: Toxicology | Authors: Anna Cyran | Application: WB - Characterization of the nucleotide excision repair pathway and evaluation of compounds for overcoming the cisplatin resistance of non‑small cell lung cancer cell lines.
Journal: Oncol Rep | Authors: Toshihiro Suzuki | Species: human | Application: WB - RNA helicase DDX3 regulates RAD51 localization and DNA damage repair in Ewing sarcoma
Journal: iScience | Authors: Matthew E Randolph | Species: human | Application: WB - The modulation of AUF1 regulates the R-loop resolution activating the immune response in DDR.
Journal: iScience | Authors: Maria Carmen Ragosta | Species: human | Application: WB - NAT10 regulates the repair of UVB-induced DNA damage and tumorigenicity
Journal: Toxicol Appl Pharmacol | Authors: Zizhao Yang | Species: human | Application: WB - Associations between Expression Levels of Nucleotide Excision Repair Proteins in Lymphoblastoid Cells and Risk of Squamous Cell Carcinoma of the Head and Neck.
Journal: Mol Carcinog | Authors: Peng Han - CLEC4M is associated with poor prognosis and promotes cisplatin resistance in NSCLC patients.
Journal: J Cancer | Authors: Li-Ming Tan | Species: human | Application: WB - The m6 A reader YTHDC2 regulates UVB-induced DNA damage repair and histone modification
Journal: Photochem Photobiol | Authors: Zizhao Yang | Species: human | Application: WB - RNA Helicase DDX3 Regulates RAD51 Localization and DNA Damage Repair in Ewing Sarcoma
Journal: bioRxiv | Authors: Matthew E Randolph | Species: human | Application: WB - Stimulation of ribosomal RNA gene promoter by transcription factor Sp1 involves active DNA demethylation by Gadd45-NER pathway.
Journal: Biochim Biophys Acta | Authors: Pallavi Rajput | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
